Filters

FMO1 Antibody

FMO1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenFMO1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the FMO1 antibody should be determined by the researcher
Intented useThis FMO1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q01740
PurityAntigen affinity
Description FMO1 found in fetal liver, FMO2 found in adult liver, Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, Several transcript variants encoding different isoforms have been found for this gene, Three forms of the enzyme, and FMO3 are encoded by genes clustered in the 1q23-q25 region, and xenobiotics, pesticides, Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria
ImmunogenAmino acids AFPFLDESVVKVEDGQASLYKYIFPAHLQK of human FMO1 were used as the immunogen for the FMO1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FMO1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetFMO1
Short nameFMO1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameflavin containing monooxygenase 1 (Antibody to)
Alternative techniqueantibodies
Alternative to gene target FMO1 and IDBG-104781 and ENSG00000010932 and 2326, FMO1 and IDBG-632123 and ENSBTAG00000021408 and 508781, Fmo1 and IDBG-202008 and ENSMUSG00000040181 and 14261, N, Plasma membranes, this GO :0004497 and monooxygenase activity and molecular function this GO :0004499 and N, this GO :0004497: monooxygenase activity, this GO :0004497: monooxygenase activity and also this GO :0004499: N, this GO :0004499: N, this GO :0016491: oxidoreductase activity, this GO :0050660: flavin adenine dinucleotide binding, this GO :0050661: NADP binding, N-dimethylaniline monooxygenase activity, N-dimethylaniline monooxygenase activity and also this GO :0016491: oxidoreductase activity and also this GO :0050660: flavin adenine dinucleotide binding and also this GO :0050661: NADP binding, N-dimethylaniline monooxygenase activity and molecular function this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0006082 and organic acid metabolic process and biological process this GO :0006805 and xenobiotic metabolic process and biological process this GO :0006970 and response to osmotic stress and biological process this GO :0009404 and toxin metabolic process and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016491 and oxidoreductase activity and molecular function this GO :0017144 and drug metabolic process and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0044281 and small molecule metabolic process and biological process this GO :0050660 and flavin adenine dinucleotide binding and molecular function this GO :0050661 and NADP binding and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0070995 and NADPH oxidation and biological process, flavin containing monooxygenase 1
Identity 3769
Gene FMO1
Long gene name flavin containing monooxygenase 1
Locus 1q24, 3
Discovery year 1991-03-18
GenBank acession M64082
Entrez gene record 2326
RefSeq identity NM_002021
Havana BLAST/BLAT OTTHUMG00000035502

Similar products

Subscribe to our Newsletter