Filters

FMO2 Antibody

FMO2 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenFMO2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the FMO2 antibody should be determined by the researcher
Intented useThis FMO2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q99518
PurityAntigen affinity
Description Alternative splicing results in multiple transcript variants, However, It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate, This gene is found in a cluster with other related family members on chromosome 1, and is likely degraded rapidly, has no catalytic activity, resulting in a protein that is C-terminally-truncated, some human populations contain an allele (FMO2*2A) with a premature stop codon, Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene (flavin containing monooxygenase 2)
ImmunogenAmino acids FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK of human FMO2 were used as the immunogen for the FMO2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FMO2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetFMO2
Short nameFMO2 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameFMO2 (Antibody to)
Alternative techniqueantibodies
Identity 3770
Gene FMO2
Long gene name flavin containing monooxygenase 2
Synonyms gene name flavin containing monooxygenase 2 (non-functional)
Locus 1q24, 3
Discovery year 1994-05-06
GenBank acession BC005894
Entrez gene record 2327
Pubmed identfication 1417778 9804831
RefSeq identity NM_001460
Havana BLAST/BLAT OTTHUMG00000035504

Similar products

Subscribe to our Newsletter