Filters

FUT1 Antibody

FUT1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenFUT1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the FUT1 antibody should be determined by the researcher
Intented useThis FUT1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P19526
PurityAntigen affinity
Description It is mapped to 19q13, Mutations in this gene are a cause of the H-Bombay blood group, The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme, which is required for the final step in the soluble A and B antigen synthesis pathway, 3, Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene
ImmunogenAmino acids EVDSRTPWRELQLHDWMSEEYADLRDPFLKL of human FUT1 were used as the immunogen for the FUT1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FUT1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membrane, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetFUT1
Short nameFUT1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name H blood group) (Antibody to), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase
Alternative techniqueantibodies
Alternative to gene target FUT1 and IDBG-61100 and ENSG00000174951 and 2523, FUT1 and IDBG-640280 and ENSBTAG00000023374 and 281174, Fut1 and IDBG-183801 and ENSMUSG00000008461 and 14343, H and HH and HSC, H blood group), Plasma membranes, fucosyltransferase activity, this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005975 and carbohydrate metabolic process and biological process this GO :0006486 and protein glycosylation and biological process this GO :0008107 and galactoside 2-alpha-L-fucosyltransferase activity and molecular function this GO :0008417 and fucosyltransferase activity and molecular function this GO :0016020 and membrane and cellular component this GO :0032580 and this GO lgi cisterna membrane and cellular component this GO :0036065 and fucosylation and biological process this GO :0042355 and L-fucose catabolic process and biological process, this GO :0008107: galactoside 2-alpha-L-fucosyltransferase activity, this GO :0008107: galactoside 2-alpha-L-fucosyltransferase activity and also this GO :0008417: fucosyltransferase activity, this GO :0008417: fucosyltransferase activity, fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase
Identity 4012
Gene FUT1
Long gene name fucosyltransferase 1 (H blood group)
Synonyms gene H HSC
Synonyms gene name Bombay phenotype included) fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase) , fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase
Synonyms name galactoside 2-alpha-L-fucosyltransferase
Locus 19q13, 33
Discovery year 1989-06-06
Entrez gene record 2523
RefSeq identity NM_000148
Classification Fucosyltransferases Blood group antigens
Havana BLAST/BLAT OTTHUMG00000183325
Locus Specific Databases Blood Group Antigen Mutation Database LRG_810

Similar products

Subscribe to our Newsletter