Filters

GAL4 Antibody / Galectin-4

GAL4 Antibody / Galectin-4 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenGAL4 / Galectin-4
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the GAL4 antibody should be determined by the researcher
Intented useThis GAL4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P56470
PurityAntigen affinity
Description LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer, The 323-amino acid LGALS4 protein contains 2 homologous, The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions, This gene is mapped to chromosome 19q13, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins, 2 based on an alignment of the LGALS4 sequence, Galectin-4 is a protein that in humans is encoded by the LGALS4 gene
ImmunogenAmino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GAL4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetGAL4 / Galectin-4
Short nameGAL4 Antibody / Galectin-4
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameGAL4 (Antibody to) / Galectin-4
Alternative techniqueantibodies
Identity 6565
Gene LGALS4
Long gene name galectin 4
Synonyms gene name 4 , galactoside-binding, lectin, soluble
Synonyms GAL4
Locus 19q13, 2
Discovery year 1993-08-24
Entrez gene record 3960
Pubmed identfication 8063692
RefSeq identity NM_006149
Classification Galectins
Havana BLAST/BLAT OTTHUMG00000182608

Similar products

Subscribe to our Newsletter