Filters

GPX4 Antibody (isoforms a/b/c)

GPX4 Antibody (isoforms a/b/c) size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenGPX4 (isoforms a/b/c)
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the GPX4 antibody should be determined by the researcher
Intented useThis GPX4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P36969
PurityAntigen affinity
Description Alternative splicing results in multiple transcript variants, Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine, In humans, The encoded protein has been identified as a moonlighting protein based on its ability to serve dual functions as a peroxidase as well as a structural protein in mature spermatozoa, This gene encodes a member of the glutathione peroxidase protein family, Through alternative splicing and transcription initiation, also known as GPX4, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified, and cytoplasm, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage, is an enzyme that in humans is encoded by the GPX4 gene, mitochondrion, organic hydroperoxide, rat produces proteins that localize to the nucleus, Glutathione peroxidase 4
ImmunogenAmino acids ASRDDWRCARSMHEFSAKDIDGHMVNLDKYR of human GPX4 were used as the immunogen for the GPX4 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GPX4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization cytoplasmic, membrane, Nuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetGPX4 (isoforms a/b/c)
Short nameGPX4 Antibody (isoforms a/b/c)
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameGPX4 (Antibody to) (isoforms a/b/c)
Alternative techniqueantibodies
Identity 4556
Gene GPX4
Long gene name glutathione peroxidase 4
Synonyms gene name glutathione peroxidase 4 (phospholipid hydroperoxidase)
Synonyms PHGPx MCSP
Synonyms name phospholipid hydroperoxidase
Locus 19p13, 3
Discovery year 1993-05-03
GenBank acession BC039849 X71973
Entrez gene record 2879
Pubmed identfication 8287691 8039723 10464096
RefSeq identity NM_002085
Classification Selenoproteins
Havana BLAST/BLAT OTTHUMG00000181874

Similar products

Subscribe to our Newsletter