Filters

GRK5 Antibody

GRK5 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenGRK5
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the GRK5 antibody should be determined by the researcher
Intented useThis GRK5 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P34947
PurityAntigen affinity
Description It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs), The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation, This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family, G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene
ImmunogenAmino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GRK5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization cytoplasmic, Nuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetGRK5
Short nameGRK5 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameG protein-coupled receptor kinase 5 (Antibody to)
Alternative techniqueantibodies
Alternative to gene target GPRK5, GRK5 and IDBG-640359 and ENSBTAG00000007981 and 281801, GRK5 and IDBG-91131 and ENSG00000198873 and 2869, Grk5 and IDBG-181926 and ENSMUSG00000003228 and 14773, nuclei, this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004703 and G-protein coupled receptor kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005080 and protein kinase C binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005543 and phospholipid binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007188 and adenylate cyclase-modulating G-protein coupled receptor signaling pathway and biological process this GO :0007217 and tachykinin receptor signaling pathway and biological process this GO :0008277 and regulation of G-protein coupled receptor protein signaling pathway and biological process this GO :0016055 and Wnt signaling pathway and biological process this GO :0016772 and transferase activity, this GO :0004672: protein kinase activity, this GO :0004672: protein kinase activity and also this GO :0004674: protein serine/threonine kinase activity and also this GO :0004703: G-protein coupled receptor kinase activity and also this GO :0004713: protein tyrosine kinase activity and also this GO :0005080: protein kinase C binding and also this GO :0005515: protein binding and also this GO :0005524: ATP binding and also this GO :0005543: phospholipid binding and also this GO :0016772: transferase activity, this GO :0004674: protein serine/threonine kinase activity, this GO :0004703: G-protein coupled receptor kinase activity, this GO :0004713: protein tyrosine kinase activity, this GO :0005080: protein kinase C binding, this GO :0005515: protein binding, this GO :0005524: ATP binding, this GO :0005543: phospholipid binding, this GO :0016772: transferase activity, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and molecular function this GO :0038032 and termination of G-protein coupled receptor signaling pathway and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0046777 and protein autophosphorylation and biological process, G protein-coupled receptor kinase 5
Identity 4544
Gene GRK5
Long gene name G protein-coupled receptor kinase 5
Synonyms gene GPRK5
Locus 10q26, 11
Discovery year 1994-03-29
GenBank acession L15388
Entrez gene record 2869
Pubmed identfication 7685906
RefSeq identity NM_005308
Havana BLAST/BLAT OTTHUMG00000019149

Similar products

Subscribe to our Newsletter