Filters

GRP78 Antibody / BiP

GRP78 Antibody / BiP size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenGRP78 / BiP
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the GRP78 antibody should be determined by the researcher
Intented useThis GRP78 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P11021
PurityAntigen affinity
Description (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi, (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER, 78kD (GRP78) or BiP, BiP is also an essential component of the translocation machinery, Shen et al, The HSPA5 gene is mapped on 9q33, The findings of Shen et al, also known as glucose-regulated protein, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum, 3, HSPA5 (heat shock 70kDa protein 5)
ImmunogenAmino acids ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE of human GRP78/BiP were used as the immunogen for the GRP78 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GRP78 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membrane, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetGRP78 / BiP
Short nameGRP78 Antibody / BiP
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameGRP78 (Antibody to) / BiP
Alternative techniqueantibodies
Identity 5238
Gene HSPA5
Long gene name heat shock protein family A (Hsp70) member 5
Synonyms gene GRP78
Synonyms gene name 78kD) heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) , heat shock 70kD protein 5 (glucose-regulated protein
Synonyms BiP
Synonyms name 78kDa , glucose-regulated protein
Locus 9q33, 3
Discovery year 1991-07-26
Entrez gene record 3309
Classification Heat shock 70kDa proteins
Havana BLAST/BLAT OTTHUMG00000020672

Similar products

Subscribe to our Newsletter