Name : HHEX Antibody / HEX
Supplier : NJS POLY
Price :406
SKU : GEN1556009616
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | HHEX / HEX |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | WB |
| Recommended dilutions | 1-0, 5ug/ml, Western blot: 0 |
| Notes | Optimal dilution of the HHEX antibody should be determined by the researcher |
| Intented use | This HHEX antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | Q03014 |
| Purity | Antigen affinity |
| Description | (1993) set out to identify homeobox genes that might play a role in hematopoiesis, And using somatic cell hybrid analysis, D'Elia et al, Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues, Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms, Hromas et al, The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located, &rsquo, Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene, s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis |
| Immunogen | Amino acids NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ of human HHEX were used as the immunogen for the HHEX antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HHEX antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | HHEX / HEX |
| Short name | HHEX Antibody / HEX |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | hematopoietically expressed homeobox (Antibody to) / HEX |
| Alternative technique | antibodies |
| Alternative to gene target | DNA binding, DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006406 and mRNA export from nucleus and biological process this GO :0007165 and signal transduction and biological process this GO :0007492 and endoderm development and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008190 and eukaryotic initiation factor 4E binding and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008301 and DNA binding, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048568 and embryonic organ development and biological process this GO :0048729 and tissue morphogenesis and biological process this GO :0048853 and forebrain morphogenesis and biological process this GO :0060431 and primary lung bud formation and biological process this GO :0061009 and common bile duct development and biological process this GO :0061010 and gall bladder development and biological process this GO :0061011 and hepatic duct development and biological process this GO :0061017 and hepatoblast differentiation and biological process this GO :0070365 and hepatocyte differentiation and biological process this GO :0070491 and repressing transcription factor binding and molecular function this GO :0071103 and DNA conformation change and biological process this GO :0071837 and HMG box domain binding and molecular function this GO :0090009 and primitive streak formation and biological process, HEX and HMPH and HOX11L-PEN and PRH and PRHX, HHEX and IDBG-637611 and ENSBTAG00000014217 and 539542, HHEX and IDBG-82541 and ENSG00000152804 and 3087, Hhex and IDBG-161747 and ENSMUSG00000024986 and 15242, bending, bending and also this GO :0017025: TBP-class protein binding and also this GO :0042803: protein homodimerization activity and also this GO :0043565: sequence-specific DNA binding and also this GO :0044212: transcription regulatory region DNA binding and also this GO :0070491: repressing transcription factor binding and also this GO :0071837: HMG box domain binding, bending and molecular function this GO :0009611 and response to wounding and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0010621 and negative regulation of transcription by transcription factor localization and biological process this GO :0010944 and negative regulation of transcription by competitive promoter binding and biological process this GO :0016055 and Wnt signaling pathway and biological process this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0016973 and poly(A)+ mRNA export from nucleus and biological process this GO :0017025 and TBP-class protein binding and molecular function this GO :0022027 and interkinetic nuclear migration and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030154 and cell differentiation and biological process this GO :0030177 and positive regulation of Wnt signaling pathway and biological process this GO :0030183 and B cell differentiation and biological process this GO :0030878 and thyroid gland development and biological process this GO :0030900 and forebrain development and biological process this GO :0030948 and negative regulation of vascular endothelial growth factor receptor signaling pathway and biological process this GO :0031016 and pancreas development and biological process this GO :0032993 and protein-DNA complex and cellular component this GO :0034504 and protein localization to nucleus and biological process this GO :0035050 and embryonic heart tube development and biological process this GO :0035264 and multicellular organism growth and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043434 and response to peptide hormone and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045736 and negative regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0045892 and negative regulation of transcription, nuclei, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001570 and vasculogenesis and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001889 and liver development and biological process this GO :0002009 and morphogenesis of an epithelium and biological process this GO :0002573 and myeloid leukocyte differentiation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003682 and chromatin binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006351 and transcription, this GO :0003677: DNA binding, this GO :0003677: DNA binding and also this GO :0003682: chromatin binding and also this GO :0003700: sequence-specific DNA binding transcription factor activity and also this GO :0005515: protein binding and also this GO :0008134: transcription factor binding and also this GO :0008190: eukaryotic initiation factor 4E binding and also this GO :0008301: DNA binding, this GO :0003682: chromatin binding, this GO :0003700: sequence-specific DNA binding transcription factor activity, this GO :0005515: protein binding, this GO :0008134: transcription factor binding, this GO :0008190: eukaryotic initiation factor 4E binding, this GO :0008301: DNA binding, this GO :0017025: TBP-class protein binding, this GO :0042803: protein homodimerization activity, this GO :0043565: sequence-specific DNA binding, this GO :0044212: transcription regulatory region DNA binding, this GO :0070491: repressing transcription factor binding, this GO :0071837: HMG box domain binding, hematopoietically expressed homeobox |
| Identity | 4901 |
| Gene | HHEX |
| Long gene name | hematopoietically expressed homeobox |
| Synonyms gene | PRHX |
| Synonyms | HEX HOX11L-PEN |
| Locus | 10q23, 33 |
| Discovery year | 1998-08-04 |
| GenBank acession | Z21533 |
| Entrez gene record | 3087 |
| Pubmed identfication | 8096636 8103988 |
| Classification | NKL subclass homeoboxes and pseudogenes |
| Havana BLAST/BLAT | OTTHUMG00000018762 |