Filters

HKDC1 Antibody

HKDC1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenHKDC1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the HKDC1 antibody should be determined by the researcher
Intented useThis HKDC1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q2TB90
PurityAntigen affinity
DescriptionHKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate
ImmunogenAmino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HKDC1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetHKDC1
Short nameHKDC1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameHKDC1 (Antibody to)
Alternative techniqueantibodies
Identity 23302
Gene HKDC1
Long gene name hexokinase domain containing 1
Synonyms FLJ37767 FLJ22761
Locus 10q22, 1
Discovery year 2004-05-27
Entrez gene record 80201
Pubmed identfication 12477932
RefSeq identity NM_025130
Havana BLAST/BLAT OTTHUMG00000018371

Similar products

Subscribe to our Newsletter