Name : IKAROS Antibody / IKZF1
Supplier : NJS POLY
Price :406
SKU : GEN5135219776
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | IKAROS / IKZF1 |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the IKAROS antibody should be determined by the researcher |
| Intented use | This IKAROS antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | Q13422 |
| Purity | Antigen affinity |
| Description | Most isoforms share a common C-terminal domain, Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes, Several alternatively spliced transcript variants encoding different isoforms have been described for this gene, The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, The isoforms, The non-DNA-binding isoforms are largely found in the cytoplasm, This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling, and are thought to function as dominant-negative factors, and for interactions with other proteins, and it functions as a regulator of lymphocyte differentiation, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, however, resulting in members with and without DNA-binding properties, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene |
| Immunogen | Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IKAROS antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Nuclear |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | IKAROS / IKZF1 |
| Short name | IKAROS Antibody / IKZF1 |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | IKAROS (Antibody to) / IKAROS family zinc finger 1 (Ikaros) |
| Alternative technique | antibodies |
| Alternative to gene target | BT, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0007049 and cell cycle and biological process this GO :0007498 and mesoderm development and biological process this GO :0016568 and chromatin modification and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030183 and B cell differentiation and biological process this GO :0030217 and T cell differentiation and biological process this GO :0030900 and forebrain development and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045660 and positive regulation of neutrophil differentiation and biological process this GO :0045892 and negative regulation of transcription, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046872 and metal ion binding and molecular function this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048535 and lymph node development and biological process this GO :0048538 and thymus development and biological process this GO :0048541 and Peyer's patch development and biological process this GO :0048732 and gland development and biological process this GO :0051138 and positive regulation of NK T cell differentiation and biological process this GO :0060041 and retina development in camera-type eye and biological process, Hs, IKZF1 and IDBG-16397 and ENSG00000185811 and 10320, Ikzf1 and IDBG-150234 and ENSMUSG00000018654 and 22778, nuclei, protein heterodimerization activity, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001779 and natural killer cell differentiation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005721 and centromeric heterochromatin and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006351 and transcription, this GO :0003677: DNA binding, this GO :0003677: DNA binding and also this GO :0003700: sequence-specific DNA binding transcription factor activity and also this GO :0005515: protein binding and also this GO :0043565: sequence-specific DNA binding and also this GO :0046872: metal ion binding and also this GO :0046982: protein heterodimerization activity, this GO :0003700: sequence-specific DNA binding transcription factor activity, this GO :0005515: protein binding, this GO :0043565: sequence-specific DNA binding, this GO :0046872: metal ion binding, this GO :0046982: protein heterodimerization activity, 54452 and IK1 and IKAROS and LyF-1 and LYF1 and PPP1R92 and PRO0758 and ZNFN1A1, 93003 and IDBG-628786 and ENSBTAG00000014016 and 541154, IKAROS family zinc finger 1 (Ikaros) |
| Identity | 13176 |
| Gene | IKZF1 |
| Long gene name | IKAROS family zinc finger 1 |
| Synonyms gene | ZNFN1A1 |
| Synonyms gene name | 1 (Ikaros) IKAROS family zinc finger 1 (Ikaros) , subfamily 1A, zinc finger protein |
| Synonyms | hIk-1 LyF-1 Hs, 54452 IKAROS PPP1R92 |
| Synonyms name | protein phosphatase 1, regulatory subunit 92 |
| Locus | 7p12, 2 |
| Discovery year | 1999-08-23 |
| GenBank acession | U40462 |
| Entrez gene record | 10320 |
| Pubmed identfication | 1439790 7935426 |
| RefSeq identity | NM_006060 |
| Classification | Protein phosphatase 1 regulatory subunits Zinc fingers C2H2-type |
| Havana BLAST/BLAT | OTTHUMG00000155907 |