Filters

IL7R Antibody / CD127

IL7R Antibody / CD127 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenIL7R / CD127
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
Intented useThis IL7R antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P16871
PurityAntigen affinity
Description Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID), Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination, It is mapped to 5p13, Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes, This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, also known as IL7R alpha, by STAT5 and histone acetylation, is a protein found on the surface of cells, The interleukin-7 receptor
ImmunogenAmino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha were used as the immunogen for the IL7R antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IL7R antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetIL7R / CD127
Short nameIL7R Antibody / CD127
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameinterleukin 7 receptor (Antibody to) / CD127
Alternative techniqueantibodies
Alternative to gene target CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, Extracellular, IL7R and IDBG-16161 and ENSG00000168685 and 3575, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, protein binding, this GO :0000018 and regulation of DNA recombination and biological process this GO :0000902 and cell morphogenesis and biological process this GO :0001915 and negative regulation of T cell mediated cytotoxicity and biological process this GO :0002377 and immunoglobulin production and biological process this GO :0003823 and antigen binding and molecular function this GO :0004896 and cytokine receptor activity and molecular function this GO :0004917 and interleukin-7 receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008361 and regulation of cell size and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016049 and cell growth and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030217 and T cell differentiation and biological process this GO :0033089 and positive regulation of T cell differentiation in thymus and biological process this GO :0038111 and interleukin-7-mediated signaling pathway and biological process this GO :0042100 and B cell proliferation and biological process this GO :0048535 and lymph node development and biological process this GO :0048872 and homeostasis of number of cells and biological process, this GO :0003823: antigen binding, this GO :0003823: antigen binding and also this GO :0004896: cytokine receptor activity and also this GO :0004917: interleukin-7 receptor activity and also this GO :0005515: protein binding, this GO :0004896: cytokine receptor activity, this GO :0004917: interleukin-7 receptor activity, this GO :0005515: protein binding, interleukin 7 receptor
Identity 6024
Gene IL7R
Long gene name interleukin 7 receptor
Synonyms CD127
Locus 5p13, 2
Discovery year 1991-08-07
GenBank acession M29696
Entrez gene record 3575
Pubmed identfication 2317865
Classification CD molecules Fibronectin type III domain containing Interleukin receptors
Havana BLAST/BLAT OTTHUMG00000090791
Locus Specific Databases IL7Rbase: Mutation registry for Interleukin-7 receptor &, deficiency LRG_74 , #945

Similar products

Subscribe to our Newsletter