| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | Insulin Receptor / INSR |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | WB |
| Recommended dilutions | 5-1ug/ml, Western blot: 0 |
| Added buffer | 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use | This Insulin Receptor antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P06213 |
| Purity | Antigen affinity |
| Description | Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells, It belongs to the large class of tyrosine kinase receptors, The INSR gene spans more than 120 kb and has 22 exons, The insulin receptor gene is mapped to 19p13, The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell, a mechanism parallel to that of its ligand, insulin, 2, Insulin receptor is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds |
| Immunogen | Amino acids 38-76 (MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL) from the human protein were used as the immunogen for the Insulin Receptor antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Insulin Receptor antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | Insulin Receptor / INSR |
| Short name | Insulin Receptor Antibody / INSR |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | Insulin Receptor (Antibody to) / insulin receptor |
| Alternative technique | antibodies |
| Alternative to gene target | BT, CD220 and HHF5, Cell surfaces, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0008544 and epidermis development and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0010008 and endosome membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016772 and transferase activity, INSR and IDBG-22529 and ENSG00000171105 and 3643, Insr and IDBG-129570 and ENSMUSG00000005534 and 16337, this GO :0000187 and activation of MAPK activity and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0003007 and heart morphogenesis and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0004716 and receptor signaling protein tyrosine kinase activity and molecular function this GO :0005009 and insulin-activated receptor activity and molecular function this GO :0005159 and insulin-like growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005899 and insulin receptor complex and cellular component this GO :0005901 and caveola and cellular component this GO :0005975 and carbohydrate metabolic process and biological process this GO :0006355 and regulation of transcription, this GO :0004672: protein kinase activity, this GO :0004672: protein kinase activity and also this GO :0004713: protein tyrosine kinase activity and also this GO :0004714: transmembrane receptor protein tyrosine kinase activity and also this GO :0004716: receptor signaling protein tyrosine kinase activity and also this GO :0005009: insulin-activated receptor activity and also this GO :0005159: insulin-like growth factor receptor binding and also this GO :0005515: protein binding and also this GO :0005524: ATP binding and also this GO :0005525: GTP binding and also this GO :0016772: transferase activity, this GO :0004713: protein tyrosine kinase activity, this GO :0004714: transmembrane receptor protein tyrosine kinase activity, this GO :0004716: receptor signaling protein tyrosine kinase activity, this GO :0005009: insulin-activated receptor activity, this GO :0005159: insulin-like growth factor receptor binding, this GO :0005515: protein binding, this GO :0005524: ATP binding, this GO :0005525: GTP binding, this GO :0016772: transferase activity, this GO :0031994: insulin-like growth factor I binding, this GO :0031995: insulin-like growth factor II binding, this GO :0043548: phosphatidylinositol 3-kinase binding, this GO :0043559: insulin binding, this GO :0043560: insulin receptor substrate binding, this GO :0051425: PTB domain binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0031994: insulin-like growth factor I binding and also this GO :0031995: insulin-like growth factor II binding and also this GO :0043548: phosphatidylinositol 3-kinase binding and also this GO :0043559: insulin binding and also this GO :0043560: insulin receptor substrate binding and also this GO :0051425: PTB domain binding, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0019087 and transformation of host cell by virus and biological process this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030238 and male sex determination and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031017 and exocrine pancreas development and biological process this GO :0031994 and insulin-like growth factor I binding and molecular function this GO :0031995 and insulin-like growth factor II binding and molecular function this GO :0032147 and activation of protein kinase activity and biological process this GO :0032148 and activation of protein kinase B activity and biological process this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0038083 and peptidyl-tyrosine autophosphorylation and biological process this GO :0042593 and glucose homeostasis and biological process this GO :0043235 and receptor complex and cellular component this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0043548 and phosphatidylinositol 3-kinase binding and molecular function this GO :0043559 and insulin binding and molecular function this GO :0043560 and insulin receptor substrate binding and molecular function this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045725 and positive regulation of glycogen biosynthetic process and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0045821 and positive regulation of glycolytic process and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045995 and regulation of embryonic development and biological process this GO :0046326 and positive regulation of glucose import and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0048639 and positive regulation of developmental growth and biological process this GO :0051290 and protein heterotetramerization and biological process this GO :0051425 and PTB domain binding and molecular function this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0060267 and positive regulation of respiratory burst and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071363 and cellular response to growth factor stimulus and biological process, 63550 and IDBG-643606 and ENSBTAG00000012687 and 408017, insulin receptor |
| Identity | 6091 |
| Gene | INSR |
| Long gene name | insulin receptor |
| Synonyms | CD220 |
| Locus | 19p13, 2 |
| Discovery year | 1986-01-01 |
| GenBank acession | M10051 |
| Entrez gene record | 3643 |
| Pubmed identfication | 2983222 |
| Classification | CD molecules Fibronectin type III domain containing Receptor Tyrosine Kinases |
| Havana BLAST/BLAT | OTTHUMG00000181992 |
Technique
Supplier
Species
Label
Iso Type
Host
Tissue