Filters

Integrin beta 3 Antibody / ITGB3 / CD61

Integrin beta 3 Antibody / ITGB3 / CD61 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenIntegrin beta 3 / ITGB3 / CD61
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the CD61 antibody should be determined by the researcher
Intented useThis CD61 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P05106
PurityAntigen affinity
Description Additionally, Although the ITGB3 is expressed on the cell surface at normal levels and is capable of function following extracellular stimulation, GPIIIa, It is a cluster of differentiation found on thrombocytes, The 3-prime exon is larger than 1, The ITGB3 complex belongs to the integrin class of cell adhesion molecule receptors that share a common heterodimeric structure with alpha and beta subunits, also called GP3A, and CD61, is a protein that in humans is encoded by the ITGB3 gene, it could not be activated via the 'inside-out' signaling pathways, the ITGB3 complex mediates platelet aggregation by acting as a receptor for fibrinogen, 700 nucleotides and contains the 3-prime untranslated region, Integrin beta 3
ImmunogenAmino acids FAKFEEERARAKWDTANNPLYKEATSTFTNITYR of human CD61 were used as the immunogen for the CD61 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CD61 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization cytoplasmic, Cell surface
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetIntegrin beta 3 / ITGB3 / CD61
Short nameIntegrin beta 3 Antibody / ITGB3 / CD61
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name antigen CD61) / CD61, b 3 (platelet glycoprotein IIIa, Integrin b 3 (Antibody to) / integrin
Alternative techniqueantibodies
Alternative to gene target BDPLT16 and BDPLT2 and CD61 and GP3A and GPIIIa and GT, ITGB3 and IDBG-547297 and ENSG00000259207 and 3690, antigen CD61), beta 3 (platelet glycoprotein IIIa, cell adhesion molecule binding, nuclei, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0002576 and platelet degranulation and biological process this GO :0003756 and protein disulfide isomerase activity and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005161 and platelet-derived growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0006457 and protein folding and biological process this GO :0007044 and cell-substrate junction assembly and biological process this GO :0007155 and cell adhesion and biological process this GO :0007160 and cell-matrix adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007411 and axon guidance and biological process this GO :0007596 and blood coagulation and biological process this GO :0008305 and integrin complex and cellular component this GO :0009986 and cell surface and cellular component this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010745 and negative regulation of macrophage derived foam cell differentiation and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0014909 and smooth muscle cell migration and biological process this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030949 and positive regulation of vascular endothelial growth factor receptor signaling pathway and biological process this GO :0031092 and platelet alpha granule membrane and cellular component this GO :0031258 and lamellipodium membrane and cellular component this GO :0031589 and cell-substrate adhesion and biological process this GO :0032147 and activation of protein kinase activity and biological process this GO :0032369 and negative regulation of lipid transport and biological process this GO :0035295 and tube development and biological process this GO :0042060 and wound healing and biological process this GO :0042470 and melanosome and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0043184 and vascular endothelial growth factor receptor 2 binding and molecular function this GO :0043235 and receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045124 and regulation of bone resorption and biological process this GO :0045715 and negative regulation of low-density lipoprotein particle receptor biosynthetic process and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050748 and negative regulation of lipoprotein metabolic process and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0050900 and leukocyte migration and biological process this GO :0060055 and angiogenesis involved in wound healing and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070527 and platelet aggregation and biological process this GO :0071062 and alphav-beta3 integrin-vitronectin complex and cellular component, this GO :0003756: protein disulfide isomerase activity, this GO :0003756: protein disulfide isomerase activity and also this GO :0004872: receptor activity and also this GO :0005161: platelet-derived growth factor receptor binding and also this GO :0005515: protein binding and also this GO :0042802: identical protein binding and also this GO :0043184: vascular endothelial growth factor receptor 2 binding and also this GO :0050839: cell adhesion molecule binding, this GO :0004872: receptor activity, this GO :0005161: platelet-derived growth factor receptor binding, this GO :0005515: protein binding, this GO :0042802: identical protein binding, this GO :0043184: vascular endothelial growth factor receptor 2 binding, this GO :0050839: cell adhesion molecule binding, integrin
Identity 6156
Gene ITGB3
Long gene name integrin subunit beta 3
Synonyms gene GP3A
Synonyms gene name antigen CD61) , beta 3 (platelet glycoprotein IIIa, integrin
Synonyms CD61 GPIIIa
Synonyms name platelet glycoprotein IIIa antigen CD61
Locus 17q21, 32
Discovery year 1988-06-09
Entrez gene record 3690
Pubmed identfication 2454952
RefSeq identity NM_000212
Classification Integrin beta subunits CD molecules
Havana BLAST/BLAT OTTHUMG00000171956
Locus Specific Databases LRG_481

Subscribe to our Newsletter