Filters

ITLN1 Antibody / Intelectin-1

ITLN1 Antibody / Intelectin-1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenITLN1 / Intelectin-1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis ITLN1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q8WWA0
PurityAntigen affinity
Description Having conserved ligand binding site residues, Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin, It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition, This gene is mapped to chromosome 1q21, also known as omentin, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose, is an intelectin encoded in humans by the ITLN1 gene, 3-q22 by genomic sequence analysis, Intelectin-1
ImmunogenAmino acids TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR were used as the immunogen for the ITLN1 antibody
Storage After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the ITLN1 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetITLN1 / Intelectin-1
Short nameITLN1 Antibody / Intelectin-1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameITLN1 (Antibody to) / Intelectin-1
Alternative techniqueantibodies
Identity 18259
Gene ITLN1
Long gene name intelectin 1
Synonyms gene name intelectin 1 (galactofuranose binding)
Synonyms ITLN FLJ20022 LFR HL-1 hIntL
Synonyms name omentin
Locus 1q23, 3
Discovery year 2003-03-14
GenBank acession AB036706
Entrez gene record 55600
Pubmed identfication 11313366 11181563
RefSeq identity NM_017625
Havana BLAST/BLAT OTTHUMG00000028604

Similar products

Subscribe to our Newsletter