Filters

KDM5B Antibody / Jarid1B

KDM5B Antibody / Jarid1B size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenKDM5B / Jarid1B
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions5-1ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis KDM5B antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q9UGL1
PurityAntigen affinity
Description Alternate splicing resultsi n multiple transcript variants, The encoded protein is capable of demethylating tri-, This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases, This protein may also play a role in genome stability and DNA repair, This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells, also known as histone demethylase JARID1B, di- and monomethylated lysine 4 of histone H3, is a demethylase enzyme that in humans is encoded by the KDM5B gene, Lysine-specific demethylase 5B
ImmunogenAmino acids 641-685 (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) from the human protein were used as the immunogen for the KDM5B antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the KDM5B antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetKDM5B / Jarid1B
Short nameKDM5B Antibody / Jarid1B
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameKDM5B (Antibody to) / Jarid1B
Alternative techniqueantibodies
Identity 18039
Gene KDM5B
Long gene name lysine demethylase 5B
Synonyms gene JARID1B
Synonyms gene name AT rich interactive domain 1B (RBP2-like) jumonji, AT rich interactive domain 1B lysine (K)-specific demethylase 5B , Jumonji
Synonyms RBBP2H1A PLU-1 CT31 PPP1R98
Synonyms name cancer/testis antigen 31 protein phosphatase 1, regulatory subunit 98
Locus 1q32, 1
Discovery year 2004-01-28
GenBank acession AJ243706
Entrez gene record 10765
Pubmed identfication 11483573 11478881
RefSeq identity NM_006618
Classification PHD finger proteins Lysine demethylases AT-rich interaction domain containing
Havana BLAST/BLAT OTTHUMG00000041401

Similar products

Subscribe to our Newsletter