Filters

KIM-1 Antibody / TIM-1 / HAVCR1

KIM-1 Antibody / TIM-1 / HAVCR1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenKIM-1 / TIM-1 / HAVCR1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the KIM1 antibody should be determined by the researcher
Intented useThis KIM1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q96D42
PurityAntigen affinity
Description HAVCR or TIM1, It may play a role in T-helper cell development and the regulation of asthma and allergic diseases, May play a role in kidney injury and repair, Receptor for TIMD4 (By similarity), [UniProt], also known as HAVCR1, is a protein that in humans is encoded by the HAVCR1 gene, Kidney injury molecule 1
ImmunogenAmino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the KIM1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetKIM-1 / TIM-1 / HAVCR1
Short nameKIM-1 Antibody / TIM-1 / HAVCR1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameKIM-1 (Antibody to) / TIM-1 / hepatitis A virus cellular receptor 1
Alternative techniqueantibodies
Alternative to gene target HAVCR1 and IDBG-55259 and ENSG00000113249 and 26762, Plasma membranes, protein binding, this GO :0001618 and virus receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0009615 and response to virus and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process, this GO :0001618: virus receptor activity, this GO :0001618: virus receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, hepatitis A virus cellular receptor 1
Identity 17866
Gene HAVCR1
Long gene name hepatitis A virus cellular receptor 1
Synonyms HAVCR-1 TIM-1 TIM1 HAVCR TIMD1 CD365 KIM1
Synonyms name T-cell immunoglobulin mucin family member 1 kidney injury molecule 1
Locus 5q33, 3
Discovery year 2002-12-04
GenBank acession AF043724
Entrez gene record 26762
Pubmed identfication 9658108 11725301 18273441
Classification CD molecules V-set domain containing
Havana BLAST/BLAT OTTHUMG00000163466

Similar products

Subscribe to our Newsletter