Name : Ku70 Antibody / XRCC6
Supplier : NJS POLY
Price :406
SKU : GEN2621459489
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | Ku70 / XRCC6 |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the Ku70 antibody should be determined by the researcher |
| Intented use | This Ku70 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P12956 |
| Purity | Antigen affinity |
| Description | 6), Complementing Defective, Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, G22P1 or TLAA, In Chinese Hamster, In addition, In early meiotic prophase, Ku70 binds directly to free DNA ends, Mre11 was abundant, The XRCC6 gene is mapped to 22q13, XRCC6 and Mre11 are differentially expressed during meiosis, XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis, also called Ku70, and reversed defective homologous recombination, committing them to NHEJ repair, diminished chromosome breaks, however, is a protein that in humans, is encoded by the XRCC6 gene, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70, when meiotic recombination is most probably initiated, whereas XRCC6 was not detectable, 000 and 80, 000 daltons that dimerize to form a 10 S DNA-binding complex, 2, XRCC6 (X-Ray Repair |
| Immunogen | Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Ku70 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Nuclear |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | Ku70 / XRCC6 |
| Short name | Ku70 Antibody / XRCC6 |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | Ku70 (Antibody to) / X-ray repair complementing defective repair in Chinese hamster cells 6 |
| Alternative technique | antibodies |
| Alternative to gene target | 5'-deoxyribose-5-phosphate lyase activity, CTC75 and CTCBF and G22P1 and KU70 and ML8 and TLAA, DNA-templated and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0007420 and brain development and biological process this GO :0008022 and protein C-terminus binding and molecular function this GO :0010212 and response to ionizing radiation and biological process this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0032481 and positive regulation of type I interferon production and biological process this GO :0032508 and DNA duplex unwinding and biological process this GO :0033151 and V(D)J recombination and biological process this GO :0042162 and telomeric DNA binding and molecular function this GO :0043234 and protein complex and cellular component this GO :0043564 and Ku70:Ku80 complex and cellular component this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045892 and negative regulation of transcription, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0050769 and positive regulation of neurogenesis and biological process this GO :0051575 and 5'-deoxyribose-5-phosphate lyase activity and molecular function this GO :0070419 and nonhomolo this GO us end joining complex and cellular component this GO :0071475 and cellular hyperosmotic salinity response and biological process this GO :0071481 and cellular response to X-ray and biological process this GO :0075713 and establishment of integrated proviral latency and biological process, XRCC6 and IDBG-641933 and ENSBTAG00000006103 and 510132, XRCC6 and IDBG-9323 and ENSG00000196419 and 2547, Xrcc6 and IDBG-165874 and ENSMUSG00000022471 and 14375, nuclei, this GO :0000723 and telomere maintenance and biological process this GO :0000783 and nuclear telomere cap complex and cellular component this GO :0003677 and DNA binding and molecular function this GO :0003684 and damaged DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003691 and double-stranded telomeric DNA binding and molecular function this GO :0004003 and ATP-dependent DNA helicase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006266 and DNA ligation and biological process this GO :0006281 and DNA repair and biological process this GO :0006302 and double-strand break repair and biological process this GO :0006303 and double-strand break repair via nonhomolo this GO us end joining and biological process this GO :0006351 and transcription, this GO :0003677: DNA binding, this GO :0003677: DNA binding and also this GO :0003684: damaged DNA binding and also this GO :0003690: double-stranded DNA binding and also this GO :0003691: double-stranded telomeric DNA binding and also this GO :0004003: ATP-dependent DNA helicase activity and also this GO :0005515: protein binding and also this GO :0005524: ATP binding and also this GO :0008022: protein C-terminus binding and also this GO :0042162: telomeric DNA binding and also this GO :0044212: transcription regulatory region DNA binding and also this GO :0044822: poly(A) RNA binding and also this GO :0051575: 5'-deoxyribose-5-phosphate lyase activity, this GO :0003684: damaged DNA binding, this GO :0003690: double-stranded DNA binding, this GO :0003691: double-stranded telomeric DNA binding, this GO :0004003: ATP-dependent DNA helicase activity, this GO :0005515: protein binding, this GO :0005524: ATP binding, this GO :0008022: protein C-terminus binding, this GO :0042162: telomeric DNA binding, this GO :0044212: transcription regulatory region DNA binding, this GO :0044822: poly(A) RNA binding, this GO :0051575: 5'-deoxyribose-5-phosphate lyase activity, X-ray repair complementing defective repair in Chinese hamster cells 6 |
| Identity | 4055 |
| Gene | XRCC6 |
| Long gene name | X-ray repair cross complementing 6 |
| Synonyms gene | G22P1 |
| Synonyms gene name | thyroid autoantigen 70kD (Ku antigen) thyroid autoantigen 70kDa (Ku antigen) X-ray repair complementing defective repair in Chinese hamster cells 6 |
| Synonyms | D22S731 D22S671 KU70 ML8 |
| Synonyms name | 70kDa , Ku autoantigen |
| Locus | 22q13, 2 |
| Discovery year | 1988-05-11 |
| GenBank acession | J04607 |
| Entrez gene record | 2547 |
| Pubmed identfication | 9200330 9223317 |
| RefSeq identity | NM_001469 |
| Classification | DNA helicases |
| Havana BLAST/BLAT | OTTHUMG00000151190 |