Filters

LIM Kinase 2 Antibody / LIMK2

LIM Kinase 2 Antibody / LIMK2 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenLIM Kinase 2 / LIMK2
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0
NotesOptimal dilution of the LIMK2 antibody should be determined by the researcher
Intented useThis LIMK2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P53671
PurityAntigen affinity
Description Although zinc fingers usually function by binding to DNA or RNA, At least three transcript variants encoding different isoforms have been found for this gene, It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton, LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers, LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain, The protein encoded by this gene is phosphorylated and activated by ROCK, There are approximately 40 known eukaryotic LIM proteins, a downstream effector of Rho, and the encoded protein, in turn, inhibiting its actin-depolymerizing activity, phosphorylates cofilin, so named for the LIM domains they contain, the LIM motif probably mediates protein-protein interactions, LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene
ImmunogenAmino acids KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD of human LIM Kinase 2 were used as the immunogen for the LIMK2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the LIMK2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetLIM Kinase 2 / LIMK2
Short nameLIM Kinase 2 Antibody / LIMK2
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameLIM phosphorylation catalyst 2 (Antibody to) / LIMK2
Alternative techniqueantibodies
Identity 6614
Gene LIMK2
Long gene name LIM domain kinase 2
Locus 22q12, 2
Discovery year 1997-08-28
GenBank acession D45906
Entrez gene record 3985
Pubmed identfication 8537403 10591208
RefSeq identity NM_016733
Classification LIM domain containing PDZ domain containing
Havana BLAST/BLAT OTTHUMG00000151251

Similar products

Subscribe to our Newsletter