Filters

MEFV Antibody / Mediterranean fever

MEFV Antibody / Mediterranean fever size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenMEFV / Mediterranean fever
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the MEFV antibody should be determined by the researcher
Intented useThis MEFV antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O15553
PurityAntigen affinity
Description Although pyrin's function is not fully understood, And Pyrin may direct the migration of white blood cells to sites of inflammation and stop or slow the inflammatory response when it is no longer needed, Inside these white blood cells, Pyrin is produced in certain white blood cells (neutrophils, Pyrin's protein structure also allows it to interact with other molecules involved in fighting infection and in the inflammatory response, Research indicates that pyrin helps regulate inflammation by interacting with the cytoskeleton, and movement of a cell, eosinophils and monocytes) that play a role in inflammation and in fighting infection, it likely assists in keeping the inflammation process under control, pyrin is found with thecytoskeleton, size, the structural framework that helps to define the shape, MEFV (Mediterranean fever) is a human gene that provides instructions for making a protein called pyrin (also known as marenostrin)
ImmunogenAmino acids PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR of human MEFV were used as the immunogen for the MEFV antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MEFV antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetMEFV / Mediterranean fever
Short nameMEFV Antibody / Mediterranean fever
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameMEFV (Antibody to) / Mediterranean fever
Alternative techniqueantibodies
Identity 6998
Gene MEFV
Long gene name MEFV, pyrin innate immunity regulator
Synonyms gene MEF
Synonyms gene name Mediterranean fever
Synonyms FMF TRIM20
Synonyms name marenostrin
Locus 16p13, 3
Discovery year 1989-10-30
GenBank acession AF018080
Entrez gene record 4210
Pubmed identfication 9288094 27066000
RefSeq identity NM_000243
Classification Tripartite motif containing Pyrin domain containing
Havana BLAST/BLAT OTTHUMG00000129324
Locus Specific Databases INFEVERS: The repertory of Familial Mediterranean Fever (FMF) and Hereditary Inflammatory Disorders Mutations LRG_190

Similar products

Subscribe to our Newsletter