Filters

MEIS1 Antibody

MEIS1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenMEIS1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the MEIS1 antibody should be determined by the researcher
Intented useThis MEIS1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O00470
PurityAntigen affinity
Description HOXA10, Homeobox genes, In addition, MEIS1 encodes a novel homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins, The Meis1 locus is isolated as a common site of viral integration involved in myeloid leukemia in BXH-2 mice, The homeodomain of MEIS1 is the only conserved motif within the entire 390-amino acid protein, This gene is mapped to chromosome 2p14-p13, and HOXB8 play important roles in leukemia, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development, several homeoproteins are involved in neoplasia: PPX1, Homeobox protein Meis1 is a protein that in humans is encoded by the MEIS1 gene
ImmunogenAmino acids DPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA of human MEIS1 were used as the immunogen for the MEIS1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MEIS1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetMEIS1
Short nameMEIS1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameMEIS1 (Antibody to)
Alternative techniqueantibodies
Identity 7000
Gene MEIS1
Long gene name Meis homeobox 1
Synonyms gene name Meis1 (mouse) homolog Meis1, myeloid ecotropic viral integration site 1 homolog (mouse)
Locus 2p14
Discovery year 1996-12-17
Entrez gene record 4211
Pubmed identfication 7565694
RefSeq identity NM_002398
Classification TALE class homeoboxes and pseudogenes
Havana BLAST/BLAT OTTHUMG00000150714

Similar products

Subscribe to our Newsletter