Filters

MEK3 Antibody / MAP2K3 / MKK3

MEK3 Antibody / MAP2K3 / MKK3 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenMEK3 / MAP2K3 / MKK3
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the MKK3 antibody should be determined by the researcher
Intented useThis MKK3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P46734
PurityAntigen affinity
Description (1997) localized the MAP2K3 gene to 17q11, And this kinase can be activated by insulin, Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, It phosphorylates and thus activates MAPK14/p38-MAPK, Rampoldi et al, The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family, This kinase is activated by mitogenic and environmental stress, and confers oncogenic transformation of primary cells, and is necessary for the expression of glucose transporter, and participates in the MAP kinase-mediated signaling cascade, which thus leads to the constitutive activation of MAPK14, 2, Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene
ImmunogenAmino acids AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS of human MAP2K3/MEK3 were used as the immunogen for the MKK3 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MKK3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetMEK3 / MAP2K3 / MKK3
Short nameMEK3 Antibody / MAP2K3 / MKK3
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameMEK3 (Antibody to) / MAP2K3 / MKK3
Alternative techniqueantibodies
Identity 6843
Gene MAP2K3
Long gene name mitogen-activated protein kinase kinase 3
Synonyms gene PRKMK3
Synonyms MEK3 MKK3 MAPKK3
Synonyms name MAPK/ERK kinase 3 MAP kinase kinase 3 dual specificity mitogen activated protein kinase kinase 3
Locus 17p11, 2
Discovery year 1997-11-11
GenBank acession L36719
Entrez gene record 5606
Pubmed identfication 9465908
RefSeq identity NM_145109
Classification Mitogen-activated protein kinase kinases
Havana BLAST/BLAT OTTHUMG00000134322

Similar products

Subscribe to our Newsletter