Filters

MMP9 Antibody / Matrix Metalloproteinase-9

MMP9 Antibody / Matrix Metalloproteinase-9 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenMMP9 / Matrix Metalloproteinase-9
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis MMP-9 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P50282
PurityAntigen affinity
Description 92 kDa gelatinase or gelatinase B (GELB), Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases, Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, The enzyme encoded by this gene degrades type IV and V collagens, also known as 92 kDa type IV collagenase, and murine studies suggest a role in tumor-associated tissue remodeling, is an enzyme that in humans is encoded by the MMP9 gene, Matrix metallopeptidase 9 (MMP-9)
ImmunogenAmino acids RRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFS were used as the immunogen for the MMP-9 antibody
Storage After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the MMP-9 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Localization cytoplasmic, Nuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetMMP9 / Matrix Metalloproteinase-9
Short nameMMP9 Antibody / Matrix Metalloproteinase-9
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name 92kDa classification IV collagenase) (Antibody to) / Matrix Metalloproteinase-9, 92kDa gelatinase, matrix metallopeptidase 9 (gelatinase B
Alternative techniqueantibodies
Alternative to gene target 92kDa gelatinase, 92kDa type IV collagenase), CLG4B and GELB and MANDP2 and MMP-9, Extracellular, MMP9 and IDBG-642990 and ENSBTAG00000020676 and 282871, MMP9 and IDBG-78722 and ENSG00000100985 and 4318, Mmp9 and IDBG-212451 and ENSMUSG00000017737 and 17395, identical protein binding, this GO :0001501 and skeletal system development and biological process this GO :0001503 and ossification and biological process this GO :0004222 and metalloendopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006508 and proteolysis and biological process this GO :0007566 and embryo implantation and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008237 and metallopeptidase activity and molecular function this GO :0008270 and zinc ion binding and molecular function this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030225 and macrophage differentiation and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0050900 and leukocyte migration and biological process this GO :0051549 and positive regulation of keratinocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :1900122 and positive regulation of receptor binding and biological process this GO :2001258 and negative regulation of cation channel activity and biological process, this GO :0004222: metalloendopeptidase activity, this GO :0004222: metalloendopeptidase activity and also this GO :0005515: protein binding and also this GO :0005518: collagen binding and also this GO :0008233: peptidase activity and also this GO :0008237: metallopeptidase activity and also this GO :0008270: zinc ion binding and also this GO :0042802: identical protein binding, this GO :0005515: protein binding, this GO :0005518: collagen binding, this GO :0008233: peptidase activity, this GO :0008237: metallopeptidase activity, this GO :0008270: zinc ion binding, this GO :0042802: identical protein binding, matrix metallopeptidase 9 (gelatinase B
Identity 7176
Gene MMP9
Long gene name matrix metallopeptidase 9
Synonyms gene CLG4B
Synonyms gene name 92kDa gelatinase, 92kDa type IV collagenase) , matrix metalloproteinase 9 (gelatinase B
Locus 20q13, 12
Discovery year 1990-03-14
Entrez gene record 4318
Pubmed identfication 2158484
Classification Matrix metallopeptidases
Havana BLAST/BLAT OTTHUMG00000033044

Similar products

Subscribe to our Newsletter