Filters

Monoamine Oxidase B Antibody / MAOB

Monoamine Oxidase B Antibody / MAOB size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenMonoamine Oxidase B / MAOB
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the MAOB antibody should be determined by the researcher
Intented useThis MAOB antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P27338
PurityAntigen affinity
Description And it is mapped on Xp11, BRAIN, Like MAOA, MAO-B inhibition is, MAO-B is involved in the breakdown of dopamine, MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues, MAOB is a member of the flavin monoamine oxidase family, This protein preferentially degrades benzylamine and phenylethylamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement, a source of reactive oxygen species, also called MAO, as well as with decreased production of hydrogen peroxide, associated with enhanced activity of dopamine, is a protein that in humans is encoded by the MAOB gene, it also degrades dopamine, therefore, 3, Monoamine oxidase B
ImmunogenAmino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MAOB antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetMonoamine Oxidase B / MAOB
Short nameMonoamine Oxidase B Antibody / MAOB
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameMonoamine Oxidase B (Antibody to) / monoamine oxidase B
Alternative techniqueantibodies
Alternative to gene target MAOB and IDBG-58401 and ENSG00000069535 and 4129, MAOB and IDBG-637878 and ENSBTAG00000001288 and 338445, Maob and IDBG-133631 and ENSMUSG00000040147 and 109731, Plasma membranes, flavin adenine dinucleotide binding, this GO :0005739 and mitochondrion and cellular component this GO :0005740 and mitochondrial envelope and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0006805 and xenobiotic metabolic process and biological process this GO :0008131 and primary amine oxidase activity and molecular function this GO :0009055 and electron carrier activity and molecular function this GO :0009636 and response to toxic substance and biological process this GO :0010044 and response to aluminum ion and biological process this GO :0010269 and response to selenium ion and biological process this GO :0014063 and negative regulation of serotonin secretion and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016491 and oxidoreductase activity and molecular function this GO :0021762 and substantia nigra development and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0042493 and response to drug and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045964 and positive regulation of dopamine metabolic process and biological process this GO :0048545 and response to steroid hormone and biological process this GO :0050660 and flavin adenine dinucleotide binding and molecular function this GO :0051412 and response to corticosterone and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0008131: primary amine oxidase activity, this GO :0008131: primary amine oxidase activity and also this GO :0009055: electron carrier activity and also this GO :0016491: oxidoreductase activity and also this GO :0042803: protein homodimerization activity and also this GO :0050660: flavin adenine dinucleotide binding, this GO :0009055: electron carrier activity, this GO :0016491: oxidoreductase activity, this GO :0042803: protein homodimerization activity, this GO :0050660: flavin adenine dinucleotide binding, monoamine oxidase B
Identity 6834
Gene MAOB
Long gene name monoamine oxidase B
Locus Xp11, 3
Discovery year 1986-01-01
Entrez gene record 4129
RefSeq identity NM_000898
Havana BLAST/BLAT OTTHUMG00000021388
Locus Specific Databases Mental Retardation database ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

Similar products

Subscribe to our Newsletter