Name : Monoamine Oxidase B Antibody / MAOB
Supplier : NJS POLY
Price :406
SKU : GEN1542044280
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | Monoamine Oxidase B / MAOB |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the MAOB antibody should be determined by the researcher |
| Intented use | This MAOB antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P27338 |
| Purity | Antigen affinity |
| Description | And it is mapped on Xp11, BRAIN, Like MAOA, MAO-B inhibition is, MAO-B is involved in the breakdown of dopamine, MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues, MAOB is a member of the flavin monoamine oxidase family, This protein preferentially degrades benzylamine and phenylethylamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement, a source of reactive oxygen species, also called MAO, as well as with decreased production of hydrogen peroxide, associated with enhanced activity of dopamine, is a protein that in humans is encoded by the MAOB gene, it also degrades dopamine, therefore, 3, Monoamine oxidase B |
| Immunogen | Amino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MAOB antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Cytoplasmic |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | Monoamine Oxidase B / MAOB |
| Short name | Monoamine Oxidase B Antibody / MAOB |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | Monoamine Oxidase B (Antibody to) / monoamine oxidase B |
| Alternative technique | antibodies |
| Alternative to gene target | MAOB and IDBG-58401 and ENSG00000069535 and 4129, MAOB and IDBG-637878 and ENSBTAG00000001288 and 338445, Maob and IDBG-133631 and ENSMUSG00000040147 and 109731, Plasma membranes, flavin adenine dinucleotide binding, this GO :0005739 and mitochondrion and cellular component this GO :0005740 and mitochondrial envelope and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0006805 and xenobiotic metabolic process and biological process this GO :0008131 and primary amine oxidase activity and molecular function this GO :0009055 and electron carrier activity and molecular function this GO :0009636 and response to toxic substance and biological process this GO :0010044 and response to aluminum ion and biological process this GO :0010269 and response to selenium ion and biological process this GO :0014063 and negative regulation of serotonin secretion and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016491 and oxidoreductase activity and molecular function this GO :0021762 and substantia nigra development and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0042493 and response to drug and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045964 and positive regulation of dopamine metabolic process and biological process this GO :0048545 and response to steroid hormone and biological process this GO :0050660 and flavin adenine dinucleotide binding and molecular function this GO :0051412 and response to corticosterone and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0008131: primary amine oxidase activity, this GO :0008131: primary amine oxidase activity and also this GO :0009055: electron carrier activity and also this GO :0016491: oxidoreductase activity and also this GO :0042803: protein homodimerization activity and also this GO :0050660: flavin adenine dinucleotide binding, this GO :0009055: electron carrier activity, this GO :0016491: oxidoreductase activity, this GO :0042803: protein homodimerization activity, this GO :0050660: flavin adenine dinucleotide binding, monoamine oxidase B |
| Identity | 6834 |
| Gene | MAOB |
| Long gene name | monoamine oxidase B |
| Locus | Xp11, 3 |
| Discovery year | 1986-01-01 |
| Entrez gene record | 4129 |
| RefSeq identity | NM_000898 |
| Havana BLAST/BLAT | OTTHUMG00000021388 |
| Locus Specific Databases | Mental Retardation database ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database |