Filters

Myosin Phosphatase Antibody / PPP1R12A

Myosin Phosphatase Antibody / PPP1R12A size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenMyosin Phosphatase / PPP1R12A
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the PPP1R12A antibody should be determined by the researcher
Intented useThis PPP1R12A antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O14974
PurityAntigen affinity
Description Jin et al, PPP1R12A is one of the subunits of myosin phosphatase, PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation, Ras activation, Sequencing analysis showed that human PPP1R12A contains 1, The PPP1R12A gene is mapped on 12q21, The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, also called MYPT1 (Myosin phosphatase target subunit 1), and transformation, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17, concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, is an enzyme that in humans is encoded by the PPP1R12A gene, 030 amino acids with a calculated molecular mass of approximately 115 kD, 2-q21, 3, PPP1R12A (Protein phosphatase 1 regulatory subunit 12A)
ImmunogenAmino acids MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD of human PPP1R12A were used as the immunogen for the PPP1R12A antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PPP1R12A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetMyosin Phosphatase / PPP1R12A
Short nameMyosin Phosphatase Antibody / PPP1R12A
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameMyosin Phosphatase (Antibody to) / PPP1R12A
Alternative techniqueantibodies
Identity 7618
Gene PPP1R12A
Long gene name protein phosphatase 1 regulatory subunit 12A
Synonyms gene MYPT1
Synonyms gene name protein phosphatase 1, regulatory (inhibitor) subunit 12A protein phosphatase 1, regulatory subunit 12A
Synonyms MBS M130
Synonyms name myosin phosphatase-targeting subunit 1 myosin binding subunit
Locus 12q21, 2-q21, 31
Discovery year 1997-12-23
GenBank acession D87930
Entrez gene record 4659
Pubmed identfication 9286714
RefSeq identity NM_002480
Classification Ankyrin repeat domain containing Protein phosphatase 1 regulatory subunits
Havana BLAST/BLAT OTTHUMG00000170100

Similar products

Subscribe to our Newsletter