Name : Myosin Phosphatase Antibody / PPP1R12A
Supplier : NJS POLY
Price :406
SKU : GEN9500661597
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | Myosin Phosphatase / PPP1R12A |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the PPP1R12A antibody should be determined by the researcher |
| Intented use | This PPP1R12A antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | O14974 |
| Purity | Antigen affinity |
| Description | Jin et al, PPP1R12A is one of the subunits of myosin phosphatase, PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation, Ras activation, Sequencing analysis showed that human PPP1R12A contains 1, The PPP1R12A gene is mapped on 12q21, The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, also called MYPT1 (Myosin phosphatase target subunit 1), and transformation, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17, concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, is an enzyme that in humans is encoded by the PPP1R12A gene, 030 amino acids with a calculated molecular mass of approximately 115 kD, 2-q21, 3, PPP1R12A (Protein phosphatase 1 regulatory subunit 12A) |
| Immunogen | Amino acids MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD of human PPP1R12A were used as the immunogen for the PPP1R12A antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PPP1R12A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Cytoplasmic |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | Myosin Phosphatase / PPP1R12A |
| Short name | Myosin Phosphatase Antibody / PPP1R12A |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | Myosin Phosphatase (Antibody to) / PPP1R12A |
| Alternative technique | antibodies |
| Identity | 7618 |
| Gene | PPP1R12A |
| Long gene name | protein phosphatase 1 regulatory subunit 12A |
| Synonyms gene | MYPT1 |
| Synonyms gene name | protein phosphatase 1, regulatory (inhibitor) subunit 12A protein phosphatase 1, regulatory subunit 12A |
| Synonyms | MBS M130 |
| Synonyms name | myosin phosphatase-targeting subunit 1 myosin binding subunit |
| Locus | 12q21, 2-q21, 31 |
| Discovery year | 1997-12-23 |
| GenBank acession | D87930 |
| Entrez gene record | 4659 |
| Pubmed identfication | 9286714 |
| RefSeq identity | NM_002480 |
| Classification | Ankyrin repeat domain containing Protein phosphatase 1 regulatory subunits |
| Havana BLAST/BLAT | OTTHUMG00000170100 |