Filters

Nav1.5 Antibody / SCNA5

Nav1.5 Antibody / SCNA5 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigen5 / SCNA5, Nav1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
Intented use5 antibodyis to be used only for research purposes and not for diagnostics, This Nav1
Uniprot #Q14524
PurityAntigen affinity
Description Alternative splicing results in several transcript variants encoding different isoforms, Defects in this gene are a cause of long QT syndrome type 3 (LQT3), The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit, This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram, an autosomal dominant cardiac disease, 5, SCN5A is the gene that encodes the cardiac sodium channel NaV1
Immunogen5 antibody, Amino acids LRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLFRQQA from the human protein were used as the immunogen for the Nav1
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Nav1, 5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target5 / SCNA5, Nav1
Short name5 Antibody / SCNA5, Nav1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name5 (Antibody to) / SCNA5, Nav1
Alternative techniqueantibodies

Similar products

Subscribe to our Newsletter