Filters

NONO Antibody / p54nrb

NONO Antibody / p54nrb size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenNONO / p54nrb
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the p54nrb antibody should be determined by the researcher
Intented useThis p54nrb antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q15233
PurityAntigen affinity
Description A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma, Alternatively spliced transcript variants have been described, Pseudogenes exist on Chromosomes 2 and 16, This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing, Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene
ImmunogenAmino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ of human NONO/p54nrb were used as the immunogen for the p54nrb antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the p54nrb antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetNONO / p54nrb
Short nameNONO Antibody / p54nrb
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameNONO (Antibody to) / p54nrb
Alternative techniqueantibodies
Identity 7871
Gene NONO
Long gene name non-POU domain containing, octamer-binding
Synonyms gene name non-POU-domain-containing, octamer-binding
Synonyms NRB54 NMT55 P54NRB P54 PPP1R114
Synonyms name 54-kD non-Pou domain-containing octamer (ATGCAAAT) binding protein protein phosphatase 1, Nuclear RNA-binding protein, regulatory subunit 114
Locus Xq13, 1
Discovery year 1992-02-06
GenBank acession L14599
Entrez gene record 4841
Pubmed identfication 8371983 9360842
RefSeq identity NM_007363
Classification Protein phosphatase 1 regulatory subunits RNA binding motif containing
Havana BLAST/BLAT OTTHUMG00000021798

Similar products

Subscribe to our Newsletter