Filters

PAb (IgG) to Bovine PGIS / PTGIS Antibody

PAb (IgG) to Bovine PGIS / PTGIS Antibody size: 50ug 597

Supplier MBS POLYCLONALS 1
Price 597
Size 50ug
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
Alternative name1Anti-Rabbit Polyclonal (IgG) to Bovine PGIS / PTGIS
Alternative name2Rabbit PAb (IgG) to Bovine PGIS / PTGIS
Alternative name3Lapin Polyclonal (IgG) to Bovinae PGIS / PTGIS
Alternative name4PGIS / PTGIS
Alternative name5 Bovine PGIS, CYP8, CYP8A1, PGIS, PTGI, PTGIS, PTGIS, Prostacyclin synthase, Prostaglandin I2 synthase, Anti-PGIS / PTGIS Antibody (aa299-329) IHC-plus
Other names Prostacyclin synthase, Prostaglandin I2 synthase, cytochrome P450, family 8, polypeptide 1, prostacyclin synthase, prostaglandin I2 (prostacyclin) synthase, prostaglandin I2 synthase, subfamily A, prostacyclin synthase
Gene namePGIS
Gene name synonimsPTGIS
Other gene names CYP8, CYP8, CYP8A1, CYP8A1, PGIS, PTGI, PTGIS, PTGIS
CategoryAntibodies
ClonalityPolyclonal
Immunoglobulin isotypeIgG
ClonePolyclonal antibody
Host organismRabbit
Species reactivity Human, Bovine
Specificity and cross-reactivity2, 3, Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1
Purification methodImmunoaffinity Purified
Form/Appearance 0, 0, 50% glycerol, pH 7, 02% sodium azide, 4, 5% BSA, TBS
Concentration2 mg/ml
Storage and shipping Avoid repeat freeze-thaw cycles, Short term: +Store productone at +4 degrees Celsius, Long term: Store productone at -20 degrees Celsius
Tested for: Immunoprecipitation (IP), Western Blot (WB), Immunohistochemistry (IHC - Paraffin)
Description Polyclonal antibodies generally are more stable and retain their reactivity under unfavorable conditions, Polyclonal antibodies have series of advantages - larger batches can be supplied at a time, Properly used, To obtain more detailed information on productone, please, refer to the full product datasheet, the time needed for production is considerably shorter, they are inexpensive to manufacture and respectively to buy, this antibody will ensure excellent and reproducible results with guaranteed success for the applications that it is tested in, productone is a polyclonal antibody of high purity and binding affinity for the antigen that it is risen against
Advisory For antibodies that are in liquid form or reconstituted lyophilized antibodies small amounts could become entrapped on the seal or the walls of the tube, Prior to use briefly centrifuge the vial to gather all the solution on the bottom, avoid cycles of freezing and thawing, please, In order to retain the quality and the affinity of productone unchanged
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by MBS Polyclonals_1 they should be stored frozen at - 24°
About 2 light chains, For storage sodium azide is added or you can call us to request azide free antibody preparations, IgG, The IgG antibody has 2 , There are 2 heavy chains, These will need colder storage temperatures, They represent 70% or more of , This antibody can be antigen purified or protein A or G purified, goat polyclonal antibodies , mouse monoclonal H&, Immunoglobulin gamma, L chain clones or rabbit, antibodies, antigen , binding sites, have 4 parts, serum 
Gene targetPAb PGIS / PTGIS
Short namePAb (IgG) PGIS / PTGIS Antibody
Technique IgGs, antibodies against human proteins, antibodies for, Antibody
IsotypeIgG
Species Bos Taurus genes are available form the Bovine Genome database, Bovine
Alternative namepolyclonal (Immunoglobulin G) to Bovine PGIS / prostaglandin I2 (prostacyclin) synthase (Antibody to)
Alternative techniqueantibodies
Alternative to gene target CYP8 and CYP8A1 and PGIS and PTGI, PTGIS and IDBG-643178 and ENSBTAG00000017537 and 101910090, PTGIS and IDBG-80513 and ENSG00000124212 and 5740, Ptgis and IDBG-213024 and ENSMUSG00000017969 and 19223, acting on paired donors, acting on paired donors, acting on paired donors, nuclei, oxidoreductase activity, this GO :0001516 and prostaglandin biosynthetic process and biological process this GO :0004497 and monooxygenase activity and molecular function this GO :0005506 and iron ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005901 and caveola and cellular component this GO :0006690 and icosanoid metabolic process and biological process this GO :0006805 and xenobiotic metabolic process and biological process this GO :0008116 and prostaglandin-I synthase activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016705 and oxidoreductase activity, this GO :0004497: monooxygenase activity, this GO :0004497: monooxygenase activity and also this GO :0005506: iron ion binding and also this GO :0005515: protein binding and also this GO :0008116: prostaglandin-I synthase activity and also this GO :0016705: oxidoreductase activity, this GO :0005506: iron ion binding, this GO :0005515: protein binding, this GO :0008116: prostaglandin-I synthase activity, this GO :0016705: oxidoreductase activity, this GO :0020037: heme binding, with incorporation or reduction of molecular oxygen, with incorporation or reduction of molecular oxygen and also this GO :0020037: heme binding, with incorporation or reduction of molecular oxygen and molecular function this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0019371 and cyclooxygenase pathway and biological process this GO :0020037 and heme binding and molecular function this GO :0032088 and negative regulation of NF-kappaB transcription factor activity and biological process this GO :0035360 and positive regulation of peroxisome proliferator activated receptor signaling pathway and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045019 and negative regulation of nitric oxide biosynthetic process and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071354 and cellular response to interleukin-6 and biological process this GO :0071456 and cellular response to hypoxia and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :1900119 and positive regulation of execution phase of apoptosis and biological process, 282021, prostaglandin I2 (prostacyclin) synthase
Identity 9603
Gene PTGIS
Long gene name prostaglandin I2 synthase
Synonyms gene name prostaglandin I2 (prostacyclin) synthase
Synonyms PGIS CYP8A1
Synonyms name cytochrome P450, family 8, polypeptide 1 prostacyclin synthase , subfamily A
Locus 20q13, 13
Discovery year 1994-07-28
Entrez gene record 5740
Pubmed identfication 8812456
Classification Cytochrome P450 family 8
Havana BLAST/BLAT OTTHUMG00000033077
Locus Specific Databases Human Cytochrome P450 (CYP) Allele Nomenclature Committee

Similar products

Subscribe to our Newsletter