Filters

PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1

PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPAR2 / F2RL1 / Thrombin Receptor-like 1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the PAR2 antibody should be determined by the researcher
Intented useThis PAR2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P55085
PurityAntigen affinity
Description Additionally, F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins, F2RL1 is also a member of the protease-activated receptor family, It is activated by proteolytic cleavage of its extracellular amino terminus, It is activated by trypsin, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection, The F2RL1 gene contains two exons and is widely expressed in human tissues, The new amino terminus functions as a tethered ligand and activates the receptor, also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), but not by thrombin, is a protein that in humans is encoded by the F2RL1 gene, Protease activated receptor 2 (PAR2)
ImmunogenAmino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PAR2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetPAR2 / F2RL1 / Thrombin Receptor-like 1
Short namePAR2 Antibody / F2RL1 / Thrombin Receptor-like 1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative namePAR2 (Antibody to) / coagulation factor II (thrombin) receptor-like 1 / Thrombin Receptor-like 1
Alternative techniqueantibodies
Alternative to gene target BT, F2RL1 and IDBG-29713 and ENSG00000164251 and 2150, F2rl1 and IDBG-173973 and ENSMUSG00000021678 and 14063, G-protein beta-subunit binding, GPR11 and PAR2, Plasma membranes, engulfment and biological process this GO :0061028 and establishment of endothelial barrier and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070493 and thrombin receptor signaling pathway and biological process this GO :0070661 and leukocyte proliferation and biological process this GO :0070963 and positive regulation of neutrophil mediated killing of gram-negative bacterium and biological process this GO :0072608 and interleukin-10 secretion and biological process this GO :0072643 and interferon-gamma secretion and biological process this GO :0090195 and chemokine secretion and biological process this GO :0090198 and negative regulation of chemokine secretion and biological process this GO :0097029 and mature dendritic cell differentiation and biological process this GO :1900135 and positive regulation of renin secretion into blood stream and biological process this GO :2000484 and positive regulation of interleukin-8 secretion and biological process this GO :2000778 and positive regulation of interleukin-6 secretion and biological process, this GO :0001965 and G-protein alpha-subunit binding and molecular function this GO :0002286 and T cell activation involved in immune response and biological process this GO :0002690 and positive regulation of leukocyte chemotaxis and biological process this GO :0002741 and positive regulation of cytokine secretion involved in immune response and biological process this GO :0003104 and positive regulation of glomerular filtration and biological process this GO :0004872 and receptor activity and molecular function this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007596 and blood coagulation and biological process this GO :0010804 and negative regulation of tumor necrosis factor-mediated signaling pathway and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0015057 and thrombin receptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0030193 and regulation of blood coagulation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030836 and positive regulation of actin filament depolymerization and biological process this GO :0031143 and pseudopodium and cellular component this GO :0031274 and positive regulation of pseudopodium assembly and biological process this GO :0031681 and G-protein beta-subunit binding and molecular function this GO :0032930 and positive regulation of superoxide anion generation and biological process this GO :0034137 and positive regulation of toll-like receptor 2 signaling pathway and biological process this GO :0034140 and negative regulation of toll-like receptor 3 signaling pathway and biological process this GO :0034141 and positive regulation of toll-like receptor 3 signaling pathway and biological process this GO :0034145 and positive regulation of toll-like receptor 4 signaling pathway and biological process this GO :0035025 and positive regulation of Rho protein signal transduction and biological process this GO :0035926 and chemokine (C-C motif) ligand 2 secretion and biological process this GO :0042119 and neutrophil activation and biological process this GO :0043122 and regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043311 and positive regulation of eosinophil degranulation and biological process this GO :0045087 and innate immune response and biological process this GO :0045909 and positive regulation of vasodilation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046328 and regulation of JNK cascade and biological process this GO :0046329 and negative regulation of JNK cascade and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0050702 and interleukin-1 beta secretion and biological process this GO :0050900 and leukocyte migration and biological process this GO :0050921 and positive regulation of chemotaxis and biological process this GO :0050927 and positive regulation of positive chemotaxis and biological process this GO :0051607 and defense response to virus and biological process this GO :0060100 and positive regulation of pha this GO cytosis, this GO :0001965: G-protein alpha-subunit binding, this GO :0001965: G-protein alpha-subunit binding and also this GO :0004872: receptor activity and also this GO :0004930: G-protein coupled receptor activity and also this GO :0005102: receptor binding and also this GO :0005515: protein binding and also this GO :0015057: thrombin receptor activity and also this GO :0031681: G-protein beta-subunit binding, this GO :0004872: receptor activity, this GO :0004930: G-protein coupled receptor activity, this GO :0005102: receptor binding, this GO :0005515: protein binding, this GO :0015057: thrombin receptor activity, this GO :0031681: G-protein beta-subunit binding, 28745 and IDBG-645161 and ENSBTAG00000034848 and 526525, coagulation factor II (thrombin) receptor-like 1
Identity 3538
Gene F2RL1
Long gene name F2R like trypsin receptor 1
Synonyms gene GPR11
Synonyms gene name coagulation factor II (thrombin) receptor-like 1
Synonyms PAR2
Synonyms name proteinase-activated receptor-2
Locus 5q13, 3
Discovery year 1997-10-27
GenBank acession BC018130
Entrez gene record 2150
Pubmed identfication 7937743 7556175
RefSeq identity NM_005242
Classification F2R receptors
Havana BLAST/BLAT OTTHUMG00000102118

Subscribe to our Newsletter