Filters

PC4 Antibody / Positive cofactor 4

PC4 Antibody / Positive cofactor 4 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPC4 / Positive cofactor 4
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis PC4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P53999
PurityAntigen affinity
DescriptionPositive controls are the same as the target vector or antibody or protein and can be spiked to the sample before the analysis starts
ImmunogenAmino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PC4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Grouppositif
Gene targetPC4 / cofactor 4
Short namePC4 Antibody / Positive cofactor 4
Technique antibodies against human proteins, antibodies for, Antibody
Alternative namePC4 (Antibody to) / Positive cofactor 4
Alternative techniqueantibodies
Identity 5456
Gene IFRD1
Long gene name interferon related developmental regulator 1
Synonyms gene name interferon-related developmental regulator 1
Synonyms PC4 TIS7
Locus 7q31, 1
Discovery year 1998-01-21
GenBank acession Y10313
Entrez gene record 3475
Pubmed identfication 9722946
RefSeq identity NM_001550
Havana BLAST/BLAT OTTHUMG00000155124

Similar products

Subscribe to our Newsletter