Filters

PCSK6 Antibody / PACE4

PCSK6 Antibody / PACE4 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPCSK6 / PACE4
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the PACE4 antibody should be determined by the researcher
Intented useThis PACE4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P29122
PurityAntigen affinity
Description Alternatively spliced transcript variants encoding different isoforms have been identified, Some of its substrates include transforming growth factor beta related proteins, The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired, This gene encodes a member of the subtilisin-like proprotein convertase family, This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues, This gene is thought to play a role in tumor progression and left-right patterning, and brain, and von Willebrand factor, gut, including neuroendocrine, liver, proalbumin, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway, Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene
ImmunogenAmino acids RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE of human PCSK6/PACE4 were used as the immunogen for the PACE4 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PACE4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetPCSK6 / PACE4
Short namePCSK6 Antibody / PACE4
Technique antibodies against human proteins, antibodies for, Antibody
Alternative namePCSK6 (Antibody to) / PACE4
Alternative techniqueantibodies
Identity 8569
Gene PCSK6
Long gene name proprotein convertase subtilisin/kexin type 6
Synonyms gene PACE4
Synonyms gene name paired basic amino acid cleaving system 4
Synonyms SPC4
Synonyms name subtilisin-like protease subtilisin-like proprotein convertase 4 subtilisin/kexin-like protease PACE4
Locus 15q26
Discovery year 1992-06-05
Entrez gene record 5046
Pubmed identfication 1741956
RefSeq identity NM_002570
Classification Proprotein convertase subtilisin/kexin family
Havana BLAST/BLAT OTTHUMG00000172097
Locus Specific Databases LRG_888

Similar products

Subscribe to our Newsletter