Filters

PGRMC1 Antibody

PGRMC1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPGRMC1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the PGRMC1 antibody should be determined by the researcher
Intented useThis PGRMC1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O00264
PurityAntigen affinity
Description Also, However, In humans, It binds and activates P450 proteins, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1), PGRMC1 shares key structural motifs with cytochrome b5, The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1, The sole biochemical function of PGRMC1 is heme-binding, These may include binding to Insig (insulin-induced gene), hormone and lipid metabolism, its expression outside of the reproductive tract and in males suggests multiple functions for the protein, the protein is encoded by the PGRMC1 gene, which are important in drug, which regulates cholesterol synthesis, Progesterone receptor membrane component 1 is a protein which co-purifies with progesterone binding proteins in the liver and ovary
ImmunogenAmino acids RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK of the human protein were used as the immunogen for the PGRMC1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PGRMC1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetPGRMC1
Short namePGRMC1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative namePGRMC1 (Antibody to)
Alternative techniqueantibodies
Identity 16090
Gene PGRMC1
Long gene name progesterone receptor membrane component 1
Synonyms HPR6, 6
Locus Xq24
Discovery year 2001-07-25
Entrez gene record 10857
Pubmed identfication 9705155
RefSeq identity NM_006667
Classification Membrane associated progesterone receptor family
Havana BLAST/BLAT OTTHUMG00000022268
Locus Specific Databases Mental Retardation database

Similar products

Subscribe to our Newsletter