Filters

PKLR Antibody

PKLR Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPKLR
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the PKLR antibody should be determined by the researcher
Intented useThis PKLR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P30613
PurityAntigen affinity
Description Defects in this enzyme, It is mapped to 1q21, Multiple transcript variants encoding different isoforms have been found for this gene, The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA), due to gene mutations or genetic variations, which is the rate-limiting step of glycolysis, Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene
ImmunogenAmino acids EAIWADDVDRRVQFGIESGKLRGFLRVGDLV of human PKLR were used as the immunogen for the PKLR antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PKLR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetPKLR
Short namePKLR Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative namePKLR (Antibody to)
Alternative techniqueantibodies
Identity 9020
Gene PKLR
Long gene name liver and RBC , pyruvate kinase
Locus 1q22
Discovery year 2001-06-22
GenBank acession BC025737 M15465
Entrez gene record 5313
Pubmed identfication 3566732
RefSeq identity NM_000298
Havana BLAST/BLAT OTTHUMG00000035875

Similar products

Subscribe to our Newsletter