Name : PML Antibody / Promyelocytic leukemia protein
Supplier : NJS POLY
Price :406
SKU : GEN8969890443
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | PML / Promyelocytic leukemia protein |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer | 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use | This PML antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P29590 |
| Purity | Antigen affinity |
| Description | Alternatively spliced transcript variants encoding different isoforms have been identified, Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions, Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals, The TRIM motif includes three zinc-binding domains, The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL), This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor, a B-box type 1 and a B-box type 2, a RING, all variants encode the same N-terminus, and a coiled-coil region, The protein encoded by this gene is a member of the tripartite motif (TRIM) family |
| Immunogen | Amino acids 141-179 (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD) from the human protein were used as the immunogen for the PML antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PML antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | cytoplasmic (isoform dependent), Nuclear |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | PML / Promyelocytic leukemia protein |
| Short name | PML Antibody / Promyelocytic leukemia protein |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | promyelocytic leukemia (Antibody to) / Promyelocytic leukemia protein |
| Alternative technique | antibodies |
| Alternative to gene target | DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006461 and protein complex assembly and biological process this GO :0006605 and protein targeting and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006977 and DNA damage response, DNA-templated and biological process this GO :0045930 and negative regulation of mitotic cell cycle and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048384 and retinoic acid receptor signaling pathway and biological process this GO :0050821 and protein stabilization and biological process this GO :0050897 and cobalt ion binding and molecular function this GO :0051457 and maintenance of protein location in nucleus and biological process this GO :0051607 and defense response to virus and biological process this GO :0051974 and negative regulation of telomerase activity and biological process this GO :0060058 and positive regulation of apoptotic process involved in mammary gland involution and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060444 and branching involved in mammary gland duct morphogenesis and biological process this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0071353 and cellular response to interleukin-4 and biological process this GO :0072332 and intrinsic apoptotic signaling pathway by p53 class mediator and biological process this GO :0090398 and cellular senescence and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :1902187 and negative regulation of viral release from host cell and biological process this GO :2000059 and negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process and biological process this GO :2000779 and regulation of double-strand break repair and biological process this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, MYL and PP8675 and RNF71 and TRIM19, PML and IDBG-21462 and ENSG00000140464 and 5371, PML and IDBG-631902 and ENSBTAG00000015779 and 100138545, Pml and IDBG-171712 and ENSMUSG00000036986 and 18854, cobalt ion binding, nuclei, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007182 and common-partner SMAD protein phosphorylation and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007569 and cell aging and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0008631 and intrinsic apoptotic signaling pathway in response to oxidative stress and biological process this GO :0009411 and response to UV and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0010522 and regulation of calcium ion transport into cytosol and biological process this GO :0016032 and viral process and biological process this GO :0016363 and nuclear matrix and cellular component this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0016605 and PML body and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030099 and myeloid cell differentiation and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030578 and PML body organization and biological process this GO :0031065 and positive regulation of histone deacetylation and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0031901 and early endosome membrane and cellular component this GO :0031965 and nuclear membrane and cellular component this GO :0032183 and SUMO binding and molecular function this GO :0032211 and negative regulation of telomere maintenance via telomerase and biological process this GO :0032469 and endoplasmic reticulum calcium ion homeostasis and biological process this GO :0032922 and circadian regulation of gene expression and biological process this GO :0032938 and negative regulation of translation in response to oxidative stress and biological process this GO :0034097 and response to cytokine and biological process this GO :0042406 and extrinsic component of endoplasmic reticulum membrane and cellular component this GO :0042752 and regulation of circadian rhythm and biological process this GO :0042771 and intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043153 and entrainment of circadian clock by photoperiod and biological process this GO :0043161 and proteasome-mediated ubiquitin-dependent protein catabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045165 and cell fate commitment and biological process this GO :0045343 and regulation of MHC class I biosynthetic process and biological process this GO :0045892 and negative regulation of transcription, this GO :0001666 and response to hypoxia and biological process this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0002230 and positive regulation of defense response to virus by host and biological process this GO :0003677 and DNA binding and molecular function this GO :0003713 and transcription coactivator activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0003677: DNA binding, this GO :0003677: DNA binding and also this GO :0003713: transcription coactivator activity and also this GO :0005515: protein binding and also this GO :0008270: zinc ion binding and also this GO :0031625: ubiquitin protein ligase binding and also this GO :0032183: SUMO binding and also this GO :0042803: protein homodimerization activity and also this GO :0046332: SMAD binding and also this GO :0046982: protein heterodimerization activity and also this GO :0050897: cobalt ion binding, this GO :0003713: transcription coactivator activity, this GO :0005515: protein binding, this GO :0008270: zinc ion binding, this GO :0031625: ubiquitin protein ligase binding, this GO :0032183: SUMO binding, this GO :0042803: protein homodimerization activity, this GO :0046332: SMAD binding, this GO :0046982: protein heterodimerization activity, this GO :0050897: cobalt ion binding, promyelocytic leukemia |
| Identity | 9113 |
| Gene | PML |
| Long gene name | promyelocytic leukemia |
| Synonyms | MYL TRIM19 RNF71 |
| Locus | 15q24, 1 |
| Discovery year | 1991-06-05 |
| GenBank acession | AB208950 |
| Entrez gene record | 5371 |
| RefSeq identity | NM_002675 |
| Classification | Tripartite motif containing Ring finger proteins |
| Havana BLAST/BLAT | OTTHUMG00000137607 |
| Locus Specific Databases | LRG_1069 |