Filters

Pokemon Antibody / ZBTB7A

Pokemon Antibody / ZBTB7A size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPokemon / ZBTB7A
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the ZBTB7A antibody should be determined by the researcher
Intented useThis ZBTB7A antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O88939
PurityAntigen affinity
Description Inactivation of ZBTB7A in vivo leads to RB downregulation, It has a critical oncosuppressive role in the prostate, It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, Notably, Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence, Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors, a long noncoding RNA precursor for an RB-targeting microRNA, also called Pokemon and FBI-1, and H19, and invasive prostate cancer, as well as downregulated at both the mRNA and protein levels, bypass of PTEN loss-induced cellular senescence, in a subset of human advanced prostate cancers, is a protein that in humans is encoded by the ZBTB7A gene, it has been also found that ZBTB7A is genetically lost, which is involved in tumor cell invasion, Zinc finger and BTB domain-containing protein 7A
ImmunogenAmino acids DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF of mouse ZBTB7A were used as the immunogen for the ZBTB7A antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ZBTB7A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetPokemon / ZBTB7A
Short namePokemon Antibody / ZBTB7A
Technique antibodies against human proteins, antibodies for, Antibody
Alternative namePokemon (Antibody to) / ZBTB7A
Alternative techniqueantibodies
Identity 18078
Gene ZBTB7A
Long gene name zinc finger and BTB domain containing 7A
Synonyms gene ZBTB7
Synonyms gene name zinc finger and BTB domain containing 7
Synonyms FBI-1 LRF DKFZp547O146 pokemon ZNF857A
Synonyms name HIV-1 inducer of short transcripts binding protein lymphoma related factor , zinc finger and BTB domain containing 7A
Locus 19p13, 3
Discovery year 2004-01-16
GenBank acession AF000561
Entrez gene record 51341
Pubmed identfication 9973611 9927193
RefSeq identity NM_015898
Classification BTB domain containing Zinc fingers C2H2-type
Havana BLAST/BLAT OTTHUMG00000181792

Similar products

Subscribe to our Newsletter