Filters

POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase

POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPOR / CYPOR / Cytochrome P450 Oxidoreductase
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the POR antibody should be determined by the researcher
Intented useThis POR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P16435
PurityAntigen affinity
Description FAD and FMN, Mutations in this gene have been associated with various diseases, The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain, The protein binds two cofactors, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome, including apparent combined p450C17 and p450C21 deficiency, which allow it to donate electrons directly from NADPH to all microsomal p450 enzymes, POR is a membrane-bound enzyme required for electron transfer from NADPH to Cytochrome p450 in the endoplasmic reticulum of theeukaryotic cell
ImmunogenAmino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK of human Cytochrome P450 Oxidoreductase were used as the immunogen for the POR antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the POR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization membrane, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetPOR / CYPOR / Cytochrome P450 Oxidoreductase
Short namePOR Antibody / CYPOR / Cytochrome P450 Oxidoreductase
Technique antibodies against human proteins, antibodies for, Antibody
Alternative namePOR (Antibody to) / CYPOR / Cytochrome P450 Oxidoreductase
Alternative techniqueantibodies
Identity 3829
Gene FRA10A
Long gene name folic acid type, fra(10)(q23, fragile site, rare, 2) , 3) or fra(10)(q24
Locus 10q23, 2 , 3 or 10q24
Discovery year 1986-01-01
Pubmed identfication 15203205

Similar products

Subscribe to our Newsletter