Filters

PSMA3 Antibody / Proteasome 20S alpha 3

PSMA3 Antibody / Proteasome 20S alpha 3 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenPSMA3 / Proteasome 20S alpha 3
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis PSMA3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P25788
PurityAntigen affinity
Description 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits, An essential function of a modified proteasome, Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway, The core structure is composed of 4 rings of 28 non-identical subunits, The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure, This gene encodes a member of the peptidase T1A family, Two alternative transcripts encoding different isoforms have been identified, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene, is the processing of class I MHC peptides, that is a 20S core alpha subunit, the immunoproteasome, Proteasome subunit alpha type-3
ImmunogenAmino acids 88-127 (LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS) from the human protein were used as the immunogen for the PSMA3 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PSMA3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization nuclear, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetPSMA3 / Proteasome 20S alpha 3
Short namePSMA3 Antibody / Proteasome 20S alpha 3
Technique antibodies against human proteins, antibodies for, Antibody
Alternative name 3 (Antibody to) / protein degradation aggregate 20S a 3, a classification, macropain) subunit, proteasome (prosome
Alternative techniqueantibodies
Alternative to gene target 3, HC8 and PSC3, PSMA3 and IDBG-646732 and ENSBTAG00000002808 and 505176, PSMA3 and IDBG-7749 and ENSG00000100567 and 5684, Psma3 and IDBG-146271 and ENSMUSG00000060073 and 19167, TAP-dependent and biological process this GO :0004175 and endopeptidase activity and molecular function this GO :0004298 and threonine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005839 and proteasome core complex and cellular component this GO :0006511 and ubiquitin-dependent protein catabolic process and biological process this GO :0006521 and regulation of cellular amino acid metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006977 and DNA damage response, alpha type, alpha-subunit complex and cellular component this GO :0031145 and anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0034641 and cellular nitrogen compound metabolic process and biological process this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0051436 and negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051437 and positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051439 and regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, macropain) subunit, nuclei, protein binding, signal transduction by p53 class mediator resulting in cell cycle arrest and biological process this GO :0010467 and gene expression and biological process this GO :0016032 and viral process and biological process this GO :0016070 and RNA metabolic process and biological process this GO :0016071 and mRNA metabolic process and biological process this GO :0019773 and proteasome core complex, this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0000209 and protein polyubiquitination and biological process this GO :0000278 and mitotic cell cycle and biological process this GO :0000502 and proteasome complex and cellular component this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002479 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0004175: endopeptidase activity, this GO :0004175: endopeptidase activity and also this GO :0004298: threonine-type endopeptidase activity and also this GO :0005515: protein binding, this GO :0004298: threonine-type endopeptidase activity, this GO :0005515: protein binding, proteasome (prosome
Identity 9532
Gene PSMA3
Long gene name proteasome subunit alpha 3
Synonyms gene name 3 , alpha type, macropain) subunit, proteasome (prosome
Synonyms HC8
Locus 14q23, 1
Discovery year 1995-05-03
Entrez gene record 5684
Pubmed identfication 2025653 8811196
RefSeq identity NM_002788
Classification Proteasome
Havana BLAST/BLAT OTTHUMG00000140319

Similar products

Subscribe to our Newsletter