Filters

RBBP4 Antibody / RbAp48 / NURF55

RBBP4 Antibody / RbAp48 / NURF55 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenRBBP4 / RbAp48 / NURF55
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the RBBP4 antibody should be determined by the researcher
Intented useThis RBBP4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q09028
PurityAntigen affinity
Description And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation, It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation, It is present in protein complexes involved in histone acetylation and chromatin assembly, This encoded protein is also part of co-repressor complexes, This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins, This protein also seems to be involved in transcriptional repression of E2F-responsive genes, Three transcript variants encoding different isoforms have been found for this gene, or NURF55) is a protein that in humans is encoded by the RBBP4 gene, which is an integral component of transcriptional silencing, Retinoblastoma binding protein 4 (also known as RbAp48
ImmunogenAmino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS of human Retinoblastoma binding protein 4 were used as the immunogen for the RBBP4 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RBBP4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetRBBP4 / RbAp48 / NURF55
Short nameRBBP4 Antibody / RbAp48 / NURF55
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameRBBP4 (Antibody to) / RbAp48 / NURF55
Alternative techniqueantibodies
Identity 9887
Gene RBBP4
Long gene name RB binding protein 4, chromatin remodeling factor
Synonyms gene name retinoblastoma-binding protein 4 retinoblastoma binding protein 4
Synonyms RbAp48 NURF55 lin-53
Locus 1p35, 1
Discovery year 1995-05-05
GenBank acession BC053904
Entrez gene record 5928
Pubmed identfication 8350924 14609955 17531812
RefSeq identity NM_005610
Classification NuRD complex Polycomb repressive complex 2 EMSY complex SIN3 histone deacetylase complex WD repeat domain containing
Havana BLAST/BLAT OTTHUMG00000007998

Similar products

Subscribe to our Newsletter