Name : Recombinant Human 4-1BB, TNFRSF9, CD137 (C-6His)
Supplier : NOVO
Price :1014
SKU : GEN8113074111
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human 4-1BB ligand receptor is produced by our Mammalian expression system and the target gene encoding Leu24-Gln186 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 18 |
| UniProt number | Q07011 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | CD137 (C-6His), TNFRSF9, 4-1BB |
| Short name | CD137 (C-6His), TNFRSF9, Recombinant 4-1BB |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | CD137 (C-6His), member 9, sapiens 4-1BB, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | 4-1BB and CD137 and CDw137 and ILA, BT, Extracellular, TNFRSF9 and IDBG-88268 and ENSG00000049249 and 3604, Tnfrsf9 and IDBG-205902 and ENSMUSG00000028965 and 21942, cytokine binding, member 9, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0019955 and cytokine binding and molecular function this GO :0042127 and regulation of cell proliferation and biological process this GO :0045087 and innate immune response and biological process this GO :0070207 and protein homotrimerization and biological process this GO :2001180 and negative regulation of interleukin-10 secretion and biological process this GO :2001183 and negative regulation of interleukin-12 secretion and biological process, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005515: protein binding and also this GO :0019955: cytokine binding, this GO :0005515: protein binding, this GO :0019955: cytokine binding, 49346 and IDBG-633668 and ENSBTAG00000003313 and 520341, tumor necrosis factor receptor superfamily |
| Identity | 11924 |
| Gene | TNFRSF9 |
| Long gene name | TNF receptor superfamily member 9 |
| Synonyms gene | ILA |
| Synonyms gene name | member 9 , tumor necrosis factor receptor superfamily |
| Synonyms | CD137 4-1BB |
| Locus | 1p36, 23 |
| Discovery year | 1996-06-12 |
| GenBank acession | L12964 |
| Entrez gene record | 3604 |
| Pubmed identfication | 8262389 8639902 |
| Classification | CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT | OTTHUMG00000001223 |