Name : Recombinant Human 5-Demethoxyubiquinone Hydroxylase, Mitochondrial, COQ7 (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN1512564324
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human DMQ hydroxylase is produced by our Mammalian expression system and the target gene encoding Ser37-Leu217 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 21, 3 kD |
| UniProt number | Q99807 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERLVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | COQ7 (C-6His), Mitochondrial, 5-Demethoxyubiquinone Hydroxylase |
| Short name | COQ7 (C-6His), Mitochondrial, Recombinant 5-Demethoxyubiquinone Hydroxylase |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | Mitochondrial, coenzyme Q7 homolog, sapiens 5-Demethoxyubiquinone Hydroxylase, ubiquinone (yeast) (C-6His), recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CAT5 and CLK-1 and CLK1, COQ7 and IDBG-17528 and ENSG00000167186 and 10229, COQ7 and IDBG-637784 and ENSBTAG00000021242 and 504771, Coq7 and IDBG-207625 and ENSMUSG00000030652 and 12850, metal ion binding, nuclei, this GO :0001306 and age-dependent response to oxidative stress and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001841 and neural tube formation and biological process this GO :0005634 and nucleus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0006744 and ubiquinone biosynthetic process and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0008340 and determination of adult lifespan and biological process this GO :0022008 and neurogenesis and biological process this GO :0022904 and respiratory electron transport chain and biological process this GO :0034599 and cellular response to oxidative stress and biological process this GO :0042775 and mitochondrial ATP synthesis coupled electron transport and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0046872 and metal ion binding and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0070584 and mitochondrion morphogenesis and biological process, this GO :0046872: metal ion binding, this GO :0046872: metal ion binding, ubiquinone (yeast), coenzyme Q7 homolog |
| Identity | 2244 |
| Gene | COQ7 |
| Long gene name | coenzyme Q7, hydroxylase |
| Synonyms gene name | 7 (rat, coenzyme Q, ubiquinone (yeast) , yeast) homolog coenzyme Q7 homolog |
| Synonyms | CLK-1 CAT5 |
| Synonyms name | 5-demethoxyubiquinone hydroxylase |
| Locus | 16p12, 3 |
| Discovery year | 1998-09-29 |
| GenBank acession | U81276 |
| Entrez gene record | 10229 |
| Pubmed identfication | 9020081 10373325 |
| RefSeq identity | NM_016138 |
| Havana BLAST/BLAT | OTTHUMG00000131455 |