Name : Recombinant Human Acyl-Protein Thioesterase 2, LYPLA2, APT2 (C-6His)
Supplier : NOVO
Price :339
SKU : GEN1261547702
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Lysophospholipase II is produced by our E, coli expression system and the target gene encoding Met1-Val231 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 25, 8 kD |
| UniProt number | O95372 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 0, 1 mM DTT, pH 8, 1M sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPVLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | APT2 (C-6His), LYPLA2, Acyl-Protein Thioesterase 2 |
| Short name | APT2 (C-6His), LYPLA2, Recombinant Acyl-Protein Thioesterase 2 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | APT2 (C-6His), LYPLA2, sapiens Acyl-Protein Thioesterase 2, recombinant H |
| Alternative technique | rec |
| Identity | 6738 |
| Gene | LYPLA2 |
| Long gene name | lysophospholipase II |
| Synonyms | APT-2 |
| Locus | 1p36, 11 |
| Discovery year | 1999-09-29 |
| GenBank acession | AF098668 |
| Entrez gene record | 11313 |
| Havana BLAST/BLAT | OTTHUMG00000002961 |