Name : Recombinant Human Aldehyde Dehydrogenase 1-A2, ALDH1A2 (N-6His)
Supplier : NOVO
Price :2283
SKU : GEN1257073688
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Aldehyde dehydrogenase 1-A2 is produced by our E, coli expression system and the target gene encoding Met1-Ser518 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 2 kD, 58 |
| UniProt number | O94788 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/Polar Packs |
| Formulation | pH7, 150 mMsodium chloride, 2 um filtered solution of 20 mM TrisHCl, 20% Glycerol, 5, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution toPTTLGTIHSPEDVIKALADHHHHHHHHHE, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MNHKVHHHHHHMTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | ALDH1A2 (N-6His), Aldehyde Dehydrogenase 1-A2 |
| Short name | ALDH1A2 (N-6His), Recombinant Aldehyde Dehydrogenase 1-A2 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | aldehyde dehydrogenase 1 family, member A2 (N-6His), sapiens Aldehyde Dehydrogenase 1-A2, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | ALDH1A2 and IDBG-13982 and ENSG00000128918 and 101928635, ALDH1A2 and IDBG-646601 and ENSBTAG00000010119 and 535075, Aldh1a2 and IDBG-182855 and ENSMUSG00000013584 and 19378, Cytoplasm, NAD or NADP as acceptor, NAD or NADP as acceptor and also this GO :0016918: retinal binding, NAD or NADP as acceptor and molecular function this GO :0016918 and retinal binding and molecular function this GO :0021915 and neural tube development and biological process this GO :0021983 and pituitary gland development and biological process this GO :0030182 and neuron differentiation and biological process this GO :0030324 and lung development and biological process this GO :0030326 and embryonic limb morphogenesis and biological process this GO :0030900 and forebrain development and biological process this GO :0030902 and hindbrain development and biological process this GO :0031016 and pancreas development and biological process this GO :0031076 and embryonic camera-type eye development and biological process this GO :0032355 and response to estradiol and biological process this GO :0033189 and response to vitamin A and biological process this GO :0034097 and response to cytokine and biological process this GO :0035115 and embryonic forelimb morphogenesis and biological process this GO :0035799 and ureter maturation and biological process this GO :0042572 and retinol metabolic process and biological process this GO :0042573 and retinoic acid metabolic process and biological process this GO :0042574 and retinal metabolic process and biological process this GO :0042904 and 9-cis-retinoic acid biosynthetic process and biological process this GO :0043010 and camera-type eye development and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0048384 and retinoic acid receptor signaling pathway and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048566 and embryonic digestive tract development and biological process this GO :0048738 and cardiac muscle tissue development and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0060324 and face development and biological process this GO :0071300 and cellular response to retinoic acid and biological process, RALDH(II) and RALDH2 and RALDH2-T, acting on the aldehyde or oxo group of donors, acting on the aldehyde or oxo group of donors, acting on the aldehyde or oxo group of donors, member A2, oxidoreductase activity, this GO :0001568 and blood vessel development and biological process this GO :0001758 and retinal dehydrogenase activity and molecular function this GO :0001822 and kidney development and biological process this GO :0001889 and liver development and biological process this GO :0001936 and regulation of endothelial cell proliferation and biological process this GO :0002138 and retinoic acid biosynthetic process and biological process this GO :0003007 and heart morphogenesis and biological process this GO :0004028 and 3-chloroallyl aldehyde dehydrogenase activity and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006776 and vitamin A metabolic process and biological process this GO :0007494 and midgut development and biological process this GO :0008152 and metabolic process and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009855 and determination of bilateral symmetry and biological process this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0009954 and proximal/distal pattern formation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0014032 and neural crest cell development and biological process this GO :0016331 and morphogenesis of embryonic epithelium and biological process this GO :0016491 and oxidoreductase activity and molecular function this GO :0016620 and oxidoreductase activity, this GO :0001758: retinal dehydrogenase activity, this GO :0001758: retinal dehydrogenase activity and also this GO :0004028: 3-chloroallyl aldehyde dehydrogenase activity and also this GO :0016491: oxidoreductase activity and also this GO :0016620: oxidoreductase activity, this GO :0004028: 3-chloroallyl aldehyde dehydrogenase activity, this GO :0016491: oxidoreductase activity, this GO :0016620: oxidoreductase activity, this GO :0016918: retinal binding, 8854, aldehyde dehydrogenase 1 family |
| Identity | 15472 |
| Gene | ALDH1A2 |
| Long gene name | aldehyde dehydrogenase 1 family member A2 |
| Synonyms gene name | aldehyde dehydrogenase 1 family, member A2 |
| Synonyms | RALDH2 |
| Synonyms name | retinaldehyde dehydrogenase 2 |
| Locus | 15q21, 3 |
| Discovery year | 2001-03-30 |
| GenBank acession | AB015228 |
| Entrez gene record | 8854 |
| Pubmed identfication | 9819382 |
| Classification | Aldehyde dehydrogenases |
| Havana BLAST/BLAT | OTTHUMG00000132624 |