| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Aldo-Keto Reductase 1C3 is produced by our Mammalian expression system and the target gene encoding Met1-Tyr323 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 37, 8 kD |
| UniProt number | P42330 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | AKR1C3 (C-6His), Aldo-Keto Reductase 1C3 |
| Short name | AKR1C3 (C-6His), Recombinant Aldo-Keto Reductase 1C3 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | aldo-keto reductase family 1, classification II) (C-6His), member complement component 3 (3-a hydroxysteroid dehydrogenase, sapiens Aldo-Keto Reductase 1C3, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | AKR1C3 and IDBG-47964 and ENSG00000196139 and 8644, DD3 and DDX and HA1753 and HAKRB and HAKRe and hluPGFS and HSD17B5 and PGFS, acting on NAD(P)H, acting on NAD(P)H, acting on NAD(P)H, member C3 (3-alpha hydroxysteroid dehydrogenase, nuclei, oxidoreductase activity, quinone or similar compound as acceptor, quinone or similar compound as acceptor and also this GO :0018636: phenanthrene 9, quinone or similar compound as acceptor and molecular function this GO :0018636 and phenanthrene 9, this GO :0000060 and protein import into nucleus, this GO :0001758: retinal dehydrogenase activity, this GO :0001758: retinal dehydrogenase activity and also this GO :0004032: alditol:NADP+ 1-oxidoreductase activity and also this GO :0004033: aldo-keto reductase (NADP) activity and also this GO :0004745: retinol dehydrogenase activity and also this GO :0004958: prostaglandin F receptor activity and also this GO :0016491: oxidoreductase activity and also this GO :0016655: oxidoreductase activity, this GO :0004032: alditol:NADP+ 1-oxidoreductase activity, this GO :0004033: aldo-keto reductase (NADP) activity, this GO :0004745: retinol dehydrogenase activity, this GO :0004958: prostaglandin F receptor activity, this GO :0016491: oxidoreductase activity, this GO :0016655: oxidoreductase activity, this GO :0018636: phenanthrene 9, this GO :0035410: dihydrotestosterone 17-beta-dehydrogenase activity, this GO :0036131: prostaglandin D2 11-ketoreductase activity, this GO :0045550: geranylgeranyl reductase activity, this GO :0045703: ketoreductase activity, this GO :0047017: prostaglandin-F synthase activity, this GO :0047020: 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity, this GO :0047023: androsterone dehydrogenase activity, this GO :0047035: testosterone dehydrogenase (NAD+) activity, this GO :0047045: testosterone 17-beta-dehydrogenase (NADP+) activity, this GO :0047086: ketosteroid monooxygenase activity, this GO :0047115: trans-1, this GO :0047718: indanol dehydrogenase activity, this GO :0047787: delta4-3-oxosteroid 5beta-reductase activity, translocation and biological process this GO :0001523 and retinoid metabolic process and biological process this GO :0001758 and retinal dehydrogenase activity and molecular function this GO :0004032 and alditol:NADP+ 1-oxidoreductase activity and molecular function this GO :0004033 and aldo-keto reductase (NADP) activity and molecular function this GO :0004745 and retinol dehydrogenase activity and molecular function this GO :0004958 and prostaglandin F receptor activity and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007584 and response to nutrient and biological process this GO :0007603 and phototransduction, type II), visible light and biological process this GO :0008202 and steroid metabolic process and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008584 and male this GO nad development and biological process this GO :0009267 and cellular response to starvation and biological process this GO :0010942 and positive regulation of cell death and biological process this GO :0016488 and farnesol catabolic process and biological process this GO :0016491 and oxidoreductase activity and molecular function this GO :0016655 and oxidoreductase activity, 10-monooxygenase activity, 10-monooxygenase activity and also this GO :0035410: dihydrotestosterone 17-beta-dehydrogenase activity and also this GO :0036131: prostaglandin D2 11-ketoreductase activity and also this GO :0045550: geranylgeranyl reductase activity and also this GO :0045703: ketoreductase activity and also this GO :0047017: prostaglandin-F synthase activity and also this GO :0047020: 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity and also this GO :0047023: androsterone dehydrogenase activity and also this GO :0047035: testosterone dehydrogenase (NAD+) activity and also this GO :0047045: testosterone 17-beta-dehydrogenase (NADP+) activity and also this GO :0047086: ketosteroid monooxygenase activity and also this GO :0047115: trans-1, 10-monooxygenase activity and molecular function this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0019371 and cyclooxygenase pathway and biological process this GO :0030216 and keratinocyte differentiation and biological process this GO :0034614 and cellular response to reactive oxygen species and biological process this GO :0034694 and response to prostaglandin stimulus and biological process this GO :0035410 and dihydrotestosterone 17-beta-dehydrogenase activity and molecular function this GO :0036131 and prostaglandin D2 11-ketoreductase activity and molecular function this GO :0042448 and progesterone metabolic process and biological process this GO :0042574 and retinal metabolic process and biological process this GO :0044259 and multicellular organismal macromolecule metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0044597 and daunorubicin metabolic process and biological process this GO :0044598 and doxorubicin metabolic process and biological process this GO :0045550 and geranylgeranyl reductase activity and molecular function this GO :0045703 and ketoreductase activity and molecular function this GO :0047017 and prostaglandin-F synthase activity and molecular function this GO :0047020 and 15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity and molecular function this GO :0047023 and androsterone dehydrogenase activity and molecular function this GO :0047035 and testosterone dehydrogenase (NAD+) activity and molecular function this GO :0047045 and testosterone 17-beta-dehydrogenase (NADP+) activity and molecular function this GO :0047086 and ketosteroid monooxygenase activity and molecular function this GO :0047115 and trans-1, 2-dihydrobenzene-1, 2-dihydrobenzene-1, 2-dihydrobenzene-1, 2-diol dehydrogenase activity, 2-diol dehydrogenase activity and also this GO :0047718: indanol dehydrogenase activity and also this GO :0047787: delta4-3-oxosteroid 5beta-reductase activity, 2-diol dehydrogenase activity and molecular function this GO :0047718 and indanol dehydrogenase activity and molecular function this GO :0047787 and delta4-3-oxosteroid 5beta-reductase activity and molecular function this GO :0048385 and regulation of retinoic acid receptor signaling pathway and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0061370 and testosterone biosynthetic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070293 and renal absorption and biological process this GO :0071276 and cellular response to cadmium ion and biological process this GO :0071277 and cellular response to calcium ion and biological process this GO :0071379 and cellular response to prostaglandin stimulus and biological process this GO :0071384 and cellular response to corticosteroid stimulus and biological process this GO :0071395 and cellular response to jasmonic acid stimulus and biological process this GO :1900053 and negative regulation of retinoic acid biosynthetic process and biological process this GO :2000224 and regulation of testosterone biosynthetic process and biological process this GO :2000353 and positive regulation of endothelial cell apoptotic process and biological process this GO :2000379 and positive regulation of reactive oxygen species metabolic process and biological process, aldo-keto reductase family 1 |
| Identity | 386 |
| Gene | AKR1C3 |
| Long gene name | aldo-keto reductase family 1 member C3 |
| Synonyms gene | HSD17B5 |
| Synonyms gene name | hydroxysteroid (17-beta) dehydrogenase 5 aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) |
| Synonyms | KIAA0119 DDX HAKRB PGFS |
| Synonyms name | dihydrodiol dehydrogenase X prostaglandin F synthase 3-alpha hydroxysteroid dehydrogenase, type II |
| Locus | 10p15, 1 |
| Discovery year | 1998-09-29 |
| GenBank acession | L43839 |
| Entrez gene record | 8644 |
| Pubmed identfication | 7650035 9792917 |
| RefSeq identity | NM_003739 |
| Classification | Aldo-keto reductases |
| Havana BLAST/BLAT | OTTHUMG00000017585 |