Name : Recombinant Human Alpha 1-Microglobulin, AMBP (C-6His)
Supplier : NOVO
Price :303
SKU : GEN3558964774
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | AMBP (C-6His) is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Alpha 1-Microglobulin |
| Molecular Weight | 21, 9 kD |
| UniProt number | P02760 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | AMBP (C-6His), Alpha 1-Microglobulin |
| Short name | AMBP (C-6His), Recombinant Alpha 1-Microglobulin |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | alpha-1-microglobulin/bikunin precursor (C-6His), sapiens a 1-Microglobulin, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | A1M and EDC1 and HCP and HI30 and IATIL and ITI and ITIL and ITILC and UTI, AMBP and IDBG-638444 and ENSBTAG00000015676 and 280996, AMBP and IDBG-81952 and ENSG00000106927 and 259, Ambp and IDBG-154074 and ENSMUSG00000028356 and 11699, Extracellular, calcium oxalate binding, this GO :0004867 and serine-type endopeptidase inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007565 and female pregnancy and biological process this GO :0009986 and cell surface and cellular component this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0016032 and viral process and biological process this GO :0018298 and protein-chromophore linkage and biological process this GO :0019855 and calcium channel inhibitor activity and molecular function this GO :0019862 and IgA binding and molecular function this GO :0020037 and heme binding and molecular function this GO :0030163 and protein catabolic process and biological process this GO :0036094 and small molecule binding and molecular function this GO :0042167 and heme catabolic process and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0046329 and negative regulation of JNK cascade and biological process this GO :0046904 and calcium oxalate binding and molecular function this GO :0050777 and negative regulation of immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, this GO :0004867: serine-type endopeptidase inhibitor activity, this GO :0004867: serine-type endopeptidase inhibitor activity and also this GO :0005515: protein binding and also this GO :0019855: calcium channel inhibitor activity and also this GO :0019862: IgA binding and also this GO :0020037: heme binding and also this GO :0036094: small molecule binding and also this GO :0042803: protein homodimerization activity and also this GO :0046904: calcium oxalate binding, this GO :0005515: protein binding, this GO :0019855: calcium channel inhibitor activity, this GO :0019862: IgA binding, this GO :0020037: heme binding, this GO :0036094: small molecule binding, this GO :0042803: protein homodimerization activity, this GO :0046904: calcium oxalate binding, alpha-1-microglobulin/bikunin precursor |
| Identity | 453 |
| Gene | AMBP |
| Long gene name | alpha-1-microglobulin/bikunin precursor |
| Synonyms gene | ITI ITIL |
| Synonyms | UTI HCP EDC1 HI30 IATIL ITILC |
| Synonyms name | growth-inhibiting protein 19 uristatin complex-forming glycoprotein heterogeneous in charge bikunin inter-alpha-trypsin inhibitor light chain protein HC uronic-acid-rich protein trypstatin |
| Locus | 9q32 |
| Discovery year | 1986-01-01 |
| GenBank acession | X04494 |
| Entrez gene record | 259 |
| Pubmed identfication | 1708673 1385302 |
| RefSeq identity | NM_001633 |
| Classification | Lipocalins |
| Havana BLAST/BLAT | OTTHUMG00000020534 |