Name : Recombinant Human Apoptosis Regulator Bcl-2 (C-6His)
Supplier : NOVO
Price :1186
SKU : GEN5416614827
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Apoptosis Regulator Bcl-2 is produced by our E, coli expression system and the target gene encoding Met1-Asp211 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 24 |
| UniProt number | P10415 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 10%Glycerol, 150 mM sodium chloride, pH8, 2 um filtered solution of 20 mM HEPES, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | Regulator Bcl-2 (C-6His) |
| Short name | Recombinant Apoptosis Regulator Bcl-2 (C-6His) |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | sapiens programmed cellular destruction Regulator Bcl-2 (C-6His), recombinant H |
| Alternative technique | rec |