Name : Recombinant Human Arginase-1, ARG1 (C-6His)
Supplier : NOVO
Price :202
SKU : GEN7168731273
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Arginase-1 is produced by our E, coli expression system and the target gene encoding Met1-lys322 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 35, 8 kD |
| UniProt number | P05089 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/Ice Pack |
| Formulation | 1 mM DTT, 150 mM sodium chloride, 20% Glycerol, pH 7, 2 um filtered solution of 20 mM Tris, 4, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | ARG1 (C-6His), Arginase-1 |
| Short name | ARG1 (C-6His), Recombinant Arginase-1 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | ARG1 (C-6His), sapiens Arginase-1, recombinant H |
| Alternative technique | rec |
| Identity | 663 |
| Gene | ARG1 |
| Long gene name | arginase 1 |
| Synonyms gene name | arginase, liver |
| Locus | 6q23, 2 |
| Discovery year | 2001-06-22 |
| Entrez gene record | 383 |
| Pubmed identfication | 22959135 |
| Havana BLAST/BLAT | OTTHUMG00000015566 |
| Locus Specific Databases | LOVD - Leiden Open Variation Database |