Name : Recombinant Human Astrocytic Phosphoprotein PEA-15, PEA15
Supplier : NOVO
Price :369
SKU : GEN3289351570
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Astrocytic Phosphoprotein PEA-15 is produced by our E, coli expression system and the target gene encoding Met1-Ala130 is expressed |
| Molecular Weight | 15, 3 kD |
| UniProt number | Q15121 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GSHMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | PEA15, Astrocytic Phosphoprotein PEA-15 |
| Short name | PEA15, Recombinant Astrocytic Phosphoprotein PEA-15 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | phosphoprotein enriched in astrocytes 15, sapiens Astrocytic Phosphoprotein PEA-15, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Cytoplasm, HMAT1 and HUMMAT1H and MAT1 and MAT1H and PEA-15 and PED, PEA15 and IDBG-104008 and ENSG00000162734 and 8682, PEA15 and IDBG-630628 and ENSBTAG00000005793 and 510586, Pea15a and IDBG-205249 and ENSMUSG00000013698 and 18611, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005875 and microtubule associated complex and cellular component this GO :0006810 and transport and biological process this GO :0006915 and apoptotic process and biological process this GO :0008643 and carbohydrate transport and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043278 and response to morphine and biological process this GO :0046325 and negative regulation of glucose import and biological process this GO :1902042 and negative regulation of extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :1902043 and positive regulation of extrinsic apoptotic signaling pathway via death domain receptors and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding, phosphoprotein enriched in astrocytes 15 |
| Identity | 8822 |
| Gene | PEA15 |
| Long gene name | phosphoprotein enriched in astrocytes 15 |
| Synonyms | HMAT1 MAT1 PED PEA-15 MAT1H HUMMAT1H |
| Synonyms name | 15kD homolog of mouse MAT-1 oncogene , Phosphoprotein enriched in astrocytes |
| Locus | 1q23, 2 |
| Discovery year | 1998-11-06 |
| GenBank acession | Y13736 |
| Entrez gene record | 8682 |
| Pubmed identfication | 9205133 |
| RefSeq identity | NM_003768 |
| Classification | Death effector domain containing |
| Havana BLAST/BLAT | OTTHUMG00000031605 |