Name : Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN7571587743
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human BTLA is produced by our Mammalian expression system and the target gene encoding Lys31-Leu150 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 14, 79 kD |
| UniProt number | Q7Z6A9 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | BTLA, CD272 (C-6His), B T-Lymphocyte Attenuator |
| Short name | BTLA, CD272 (C-6His), Recombinant B- T-Lymphocyte Attenuator |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | B and T lymphocyte associated, CD272 (C-6His), sapiens B- and T-Lymphocyte Attenuator, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | BTLA and IDBG-49858 and ENSG00000186265 and 151888, BTLA and IDBG-632288 and ENSBTAG00000011871 and 531767, Btla and IDBG-162900 and ENSMUSG00000052013 and 208154, Cell surfaces, protein binding, this GO :0002768 and immune response-regulating cell surface receptor signaling pathway and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0030889 and negative regulation of B cell proliferation and biological process this GO :0031295 and T cell costimulation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0046642 and negative regulation of alpha-beta T cell proliferation and biological process, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, B and T lymphocyte associated |
| Identity | 21087 |
| Gene | BTLA |
| Long gene name | B and T lymphocyte associated |
| Synonyms | BTLA1 CD272 |
| Locus | 3q13, 2 |
| Discovery year | 2003-08-20 |
| GenBank acession | AY293286 |
| Entrez gene record | 151888 |
| Pubmed identfication | 12796776 |
| RefSeq identity | NM_181780 |
| Classification | Immunoglobulin like domain containing CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000159255 |