Name : Recombinant Human B-Cell Differentiation Antigen CD72, Lyb‑2 (N-Trx, 6His)
Supplier : NOVO
Price :202
SKU : GEN6853648679
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | 6His tag at the N-terminus, Recombinant Human CD72 is produced by our E, coli expression system and the target gene encoding Arg117-Cys226 is expressed with a Trx |
| Molecular Weight | 30, 6 kD |
| UniProt number | P21854 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | 6His), Lyb‑2 (N-Trx, B Differentiation CD72 |
| Short name | 6His), Lyb‑2 (N-Trx, Recombinant B-Cell Differentiation Antigen CD72 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans |
| Alternative name | 6His), Lyb‑2 (N-Trx, sapiens B-cellular Differentiation protein CD72 molecule, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | CD72 and IDBG-62668 and ENSG00000137101 and 971, CD72 and IDBG-633031 and ENSBTAG00000011409 and 783725, CD72b and LYB2, Cd72 and IDBG-141026 and ENSMUSG00000028459 and 12517, Plasma membranes, carbohydrate binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007411 and axon guidance and biological process this GO :0030246 and carbohydrate binding and molecular function, this GO :0004888: transmembrane signaling receptor activity, this GO :0004888: transmembrane signaling receptor activity and also this GO :0005102: receptor binding and also this GO :0005515: protein binding and also this GO :0030246: carbohydrate binding, this GO :0005102: receptor binding, this GO :0005515: protein binding, this GO :0030246: carbohydrate binding, CD72 molecule |
| Identity | 1696 |
| Gene | CD72 |
| Long gene name | CD72 molecule |
| Synonyms gene name | CD72 antigen |
| Synonyms | LYB2 CD72b |
| Locus | 9p13, 3 |
| Discovery year | 1991-10-04 |
| Entrez gene record | 971 |
| Pubmed identfication | 2044654 1711157 |
| RefSeq identity | NM_001782 |
| Classification | CD molecules C-type lectin domain containing |
| Havana BLAST/BLAT | OTTHUMG00000019870 |