Name : Recombinant Human B7 Homolog 4, B7-H4, VTCN1
Supplier : NOVO
Price :2283
SKU : GEN7404230461
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human B7 Homolog 4 is produced by our expression system and the target gene encoding Phe29-Ala258 is expressed |
| Molecular Weight | 25, 3 kD |
| UniProt number | Q7Z7D3 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | B7-H4, VTCN1, B7 Homolog 4 |
| Short name | B7-H4, VTCN1, Recombinant B7 Homolog 4 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | B7-H4, V-set domain containing T cellular activation inhibitor 1, sapiens B7 Homolog 4, recombinant H |
| Alternative technique | rec |
| Alternative to gene target | Cell surfaces, VTCN1 and IDBG-101440 and ENSG00000134258 and 79679, VTCN1 and IDBG-634392 and ENSBTAG00000014466 and 539919, Vtcn1 and IDBG-179327 and ENSMUSG00000051076 and 242122, protein binding, this GO :0001562 and response to protozoan and biological process this GO :0002376 and immune system process and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0050868 and negative regulation of T cell activation and biological process this GO :0072602 and interleukin-4 secretion and biological process this GO :0072643 and interferon-gamma secretion and biological process this GO :1900042 and positive regulation of interleukin-2 secretion and biological process, this GO :0005102: receptor binding, this GO :0005102: receptor binding and also this GO :0005515: protein binding, this GO :0005515: protein binding, V-set domain containing T cell activation inhibitor 1 |
| Identity | 28873 |
| Gene | VTCN1 |
| Long gene name | V-set domain containing T-cell activation inhibitor 1 |
| Synonyms gene name | V-set domain containing T cell activation inhibitor 1 |
| Synonyms | B7-H4 FLJ22418 B7S1 B7X B7H4 |
| Synonyms name | B7 family member, H4 B7 superfamily member 1 |
| Locus | 1p13, 1-p12 |
| Discovery year | 2005-02-25 |
| GenBank acession | BX648021 |
| Entrez gene record | 79679 |
| Pubmed identfication | 12818165 12818166 |
| RefSeq identity | NM_024626 |
| Classification | V-set domain containing Immunoglobulin like domain containing |
| Havana BLAST/BLAT | OTTHUMG00000012118 |