Name : Recombinant Human Bcl-2-like Protein 11, BIML (N-6His)
Supplier : NOVO
Price :202
SKU : GEN5705662094
| Reacts with | Human |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Human Bcl-2-like Protein 11 is produced by our E, coli expression system and the target gene encoding Met1-Arg120 is expressed with a 6His tag at the N-terminus |
| Molecular Weight | 15 kD |
| UniProt number | O43521-2 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 10% glycerol, 150 mM sodium chloride, 2 mM DTT, pH8, 2 um filtered solution of 20 mM HEPES, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MNHKVHHHHHHMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Properties | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group | recombinants |
| Gene target | BIML (N-6His), Bcl-2-like Protein 11 |
| Short name | BIML (N-6His), Recombinant Bcl-2-like Protein 11 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Humans, Human |
| Alternative name | BIML (N-6His), sapiens Bcl-2-like Protein 11, recombinant H |
| Alternative technique | rec |
| Identity | 994 |
| Gene | BCL2L11 |
| Long gene name | BCL2 like 11 |
| Synonyms gene name | BCL2-like 11 (apoptosis facilitator) |
| Synonyms | BOD BimL BimEL BimS BIM |
| Locus | 2q13 |
| Discovery year | 1999-12-10 |
| GenBank acession | AF032458 |
| Entrez gene record | 10018 |
| Pubmed identfication | 9731710 9430630 |
| Classification | BCL2 homology region 3 (BH3) only |
| Havana BLAST/BLAT | OTTHUMG00000131256 |
| Locus Specific Databases | LRG_620 |